BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30237 (639 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052112-1|AAK93536.1| 361|Drosophila melanogaster SD05956p pro... 29 5.3 AL031765-11|CAA21129.1| 361|Drosophila melanogaster EG:22E5.3 p... 29 5.3 AE014298-328|AAF45719.1| 361|Drosophila melanogaster CG4061-PA ... 29 5.3 >AY052112-1|AAK93536.1| 361|Drosophila melanogaster SD05956p protein. Length = 361 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 636 VSLVLYNGCPTLYTRIYKSRMVVPAGADLHYAPPPVYMHVERLEN 502 ++L+ P L SR++V G ++ +APP YM L N Sbjct: 100 ITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVLLPN 144 >AL031765-11|CAA21129.1| 361|Drosophila melanogaster EG:22E5.3 protein. Length = 361 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 636 VSLVLYNGCPTLYTRIYKSRMVVPAGADLHYAPPPVYMHVERLEN 502 ++L+ P L SR++V G ++ +APP YM L N Sbjct: 100 ITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVLLPN 144 >AE014298-328|AAF45719.1| 361|Drosophila melanogaster CG4061-PA protein. Length = 361 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 636 VSLVLYNGCPTLYTRIYKSRMVVPAGADLHYAPPPVYMHVERLEN 502 ++L+ P L SR++V G ++ +APP YM L N Sbjct: 100 ITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVLLPN 144 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,171,650 Number of Sequences: 53049 Number of extensions: 636018 Number of successful extensions: 1598 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1598 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2682985500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -