Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30234
         (555 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    23   1.8  
DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.    21   9.5  

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 10/41 (24%), Positives = 20/41 (48%)
 Frame = +1

Query: 208 CDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQ 330
           C+  G  ++ + +  DG PI+ N+    +E    +   +YQ
Sbjct: 349 CNFEGNPIKTISWLKDGHPIDHNEAVLRIESVRKEDKGMYQ 389


>DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.
          Length = 314

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 269 MRMTLQHHLRWK 304
           + MTL HH R+K
Sbjct: 69  LEMTLAHHCRFK 80


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,300
Number of Sequences: 336
Number of extensions: 2404
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13725787
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)