BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30233 (627 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 29 0.73 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 28 1.3 SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 27 2.9 SPAC1F5.09c |shk2|pak2|PAK-related kinase Shk2 |Schizosaccharomy... 25 6.8 SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ... 25 6.8 SPAC2F3.06c |kap104||karyopherin Kap104|Schizosaccharomyces pomb... 25 6.8 SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|ch... 25 9.0 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 28.7 bits (61), Expect = 0.73 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 85 KPPPRPAVSAPEYNRAARDPAFFGPPCMMGPRLT 186 K PP P AP N ++R P+ F PP P +T Sbjct: 200 KVPPPPLSQAPVANTSSR-PSSFAPPAGHAPNVT 232 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 27.9 bits (59), Expect = 1.3 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +1 Query: 16 PPWQQWRPARSNSGLRVRYWSRQKPP---PRPAVSAPEYNRAARDPAFFGPP 162 PP Q + PA S+S ++Y PP P P V A Y +A + P P Sbjct: 210 PPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQA--YPQAPQQPIVVAQP 259 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 26.6 bits (56), Expect = 2.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 3 PPLLPSLAAVEACSKQLRTEGSILEPPKAATSPSCL 110 P +LPS+ ++E+ +L T+GS E P +PS + Sbjct: 320 PSILPSIPSLESGKAELPTDGS-FEQPGYPMNPSMM 354 >SPAC1F5.09c |shk2|pak2|PAK-related kinase Shk2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 25.4 bits (53), Expect = 6.8 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 407 VDESVVLRA*TVRVESLERGRELQHVHAQSFLHR 508 +++S + A R+ LE + +QH+HA++ +HR Sbjct: 401 IEKSKLTEAQIARI-CLETCKGIQHLHARNIIHR 433 >SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1427 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 182 NRGPIMQGGPKKAGSLAARLYSGAE 108 + G + GG K+ SLA LYS AE Sbjct: 702 SNGSSLSGGQKQRVSLARALYSNAE 726 >SPAC2F3.06c |kap104||karyopherin Kap104|Schizosaccharomyces pombe|chr 1|||Manual Length = 910 Score = 25.4 bits (53), Expect = 6.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 430 AQNDRLIDIPDMITVLTTL 374 AQND +D+PD ++TTL Sbjct: 647 AQNDPTVDVPDRDFLVTTL 665 >SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 979 Score = 25.0 bits (52), Expect = 9.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 558 SAKEFISSIIFGWSQCVVSNS 620 S KEF+ ++ WS C + NS Sbjct: 360 SKKEFVHDLMLIWSNCFLYNS 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,408,922 Number of Sequences: 5004 Number of extensions: 48167 Number of successful extensions: 161 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -