BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30233 (627 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR... 29 3.3 At4g25900.1 68417.m03724 aldose 1-epimerase family protein simil... 28 5.8 At4g24010.1 68417.m03450 cellulose synthase family protein simil... 28 5.8 At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) fa... 27 7.7 At3g01740.1 68416.m00111 expressed protein 27 7.7 >At5g11250.1 68418.m01314 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1189 Score = 28.7 bits (61), Expect = 3.3 Identities = 26/113 (23%), Positives = 52/113 (46%), Gaps = 2/113 (1%) Frame = -3 Query: 538 SAYRTALKLRTVQKALCMHMLQLPAAL-EAFDSHGLRAQN-DRLIDIPDMITVLTTLYEV 365 S+ A+ L+ + C +L+LP+++ A + + N L+++P I L L E+ Sbjct: 836 SSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQEL 895 Query: 364 IAAENPSAVNVPLCLDLSMNWLLNVYDSQRTGQIRVLSFKVGLVLLCKGHLEE 206 I ++P+ ++L +L + D + +S V + LC +EE Sbjct: 896 ILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEE 948 >At4g25900.1 68417.m03724 aldose 1-epimerase family protein similar to apospory-associated protein C; APOC [Chlamydomonas reinhardtii] GI:6970044 Pfam profile PF01263: Aldose 1-epimerase Length = 318 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 16 PPWQQWRPARSNSGLRVRYWSRQ-KPPPRPAVSAPEYNRAAR 138 P + P S+ +R R+W + KPPP P++S + R Sbjct: 97 PQYSNTGPLPSHGFVRQRFWEVETKPPPLPSLSTAHVDLIVR 138 >At4g24010.1 68417.m03450 cellulose synthase family protein similar to Zea mays cellulose synthase-5 [gi:9622882], -4 [gi:9622880] Length = 770 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +3 Query: 183 NRNKYLYFSSRCPLQSNTKPTLKLNTLICPVRWLSYTFSSQFMERSRHSG 332 +R+ +YFSS +S+ LK N L C V + Y +E SG Sbjct: 173 DRSPEVYFSSESHSRSDEAENLKTNILKCEVEQMMYEDMKSRVEHVVESG 222 >At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 193 Score = 27.5 bits (58), Expect = 7.7 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +1 Query: 7 LYCPPW-QQWRPARSNSGLRVRYWSRQKPPPRPAVSAPEYNRAARDPAFFGPPCMMGPRL 183 L+C P +W A +NS RV + ++ PP+ V + + A P +G P+ Sbjct: 39 LFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATLVP-IYGRG-QKAPQ- 95 Query: 184 TGINTYTFPRGVLY 225 +G N + P G +Y Sbjct: 96 SGSNVPSRPTGPVY 109 >At3g01740.1 68416.m00111 expressed protein Length = 126 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 103 LGEVAAFGGSNIEPSVRSCFEQASTAAKEGSKGG 2 + + GS+ + VR F A++ AK+G KGG Sbjct: 1 MNRIGLIRGSSSKDVVRRTFAAAASKAKKGGKGG 34 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,427,480 Number of Sequences: 28952 Number of extensions: 287895 Number of successful extensions: 1073 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -