BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30230 (591 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 0.60 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 2.4 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 24 3.2 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 4.2 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 23 5.6 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 9.8 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 23 9.8 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 9.8 AF185642-1|AAF15577.1| 103|Anopheles gambiae Toll-related prote... 23 9.8 AF185641-1|AAF15576.1| 116|Anopheles gambiae Toll protein. 23 9.8 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 26.6 bits (56), Expect = 0.60 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 442 GDLNVVYL-VNSGSEANELATLLAKAYTGNLDIISLQTSYH 561 G N+ + +N+ S A +L L T +LD+I LQ YH Sbjct: 14 GSCNIASININTISSATKLEALKTFIRTMDLDVIFLQEVYH 54 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 24.6 bits (51), Expect = 2.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 374 IRPTCTDIRKSMSTSNN 424 ++P+ TDIR+ S SNN Sbjct: 452 LQPSSTDIRRGTSNSNN 468 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 24.2 bits (50), Expect = 3.2 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 265 DGKRYLDLFGGIVTVSVGHCHPKVNAALKDQLDVLWHTTNLYRHPKIYEYVE 420 D +R +D+ G +V S P NA L L + H Y H Y Y+E Sbjct: 336 DEQRGIDILGDVVEAS--SLTP--NAQLYGSLHNMGHNVIAYVHDPDYRYLE 383 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 4.2 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 119 VGGILAVLYVLTMSKHNFVPLLAISMCFSVEAIAICHT 6 VG + A V+TM NF+ LA S+ E I+ C+T Sbjct: 82 VGPLQAFHRVITME--NFMKTLAPSLWPPAERISFCYT 117 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 23.4 bits (48), Expect = 5.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 297 NRHRLRGPLSSESKCSPQRSTRCIVAYDQP 386 +RH L+ L + C Q++ +C+ A P Sbjct: 107 DRHYLQYGLGQDYNCFRQKAEQCLAANTSP 136 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 22.6 bits (46), Expect = 9.8 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 108 NAADG--FRAQTVHGTFVPTSRTNERSLHAAFN 200 NA+ G ++ + HG V TSR + + AFN Sbjct: 185 NASGGGSYKLKNEHGQTVSTSRAELQKILLAFN 217 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +1 Query: 367 LWHTTNLYRHPKIYEYVEQLAAKLPG 444 LW L +P+I +++ ++ A++PG Sbjct: 166 LWLGYELAPYPRIRDWLGRVVAEIPG 191 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 22.6 bits (46), Expect = 9.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 470 TVDQKLMNWRLCWRKR 517 T+++ MN++LCW R Sbjct: 918 TLERDPMNFKLCWHVR 933 >AF185642-1|AAF15577.1| 103|Anopheles gambiae Toll-related protein protein. Length = 103 Score = 22.6 bits (46), Expect = 9.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 470 TVDQKLMNWRLCWRKR 517 T+++ MN++LCW R Sbjct: 11 TLERDPMNFKLCWHVR 26 >AF185641-1|AAF15576.1| 116|Anopheles gambiae Toll protein. Length = 116 Score = 22.6 bits (46), Expect = 9.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 470 TVDQKLMNWRLCWRKR 517 T+++ MN++LCW R Sbjct: 19 TLERDPMNFKLCWHVR 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,811 Number of Sequences: 2352 Number of extensions: 15594 Number of successful extensions: 81 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -