BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30228 (732 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41273-7|AAP68952.1| 237|Caenorhabditis elegans Hypothetical pr... 28 5.9 U41273-6|AAA82457.2| 404|Caenorhabditis elegans Hypothetical pr... 28 5.9 AL132876-7|CAD21659.1| 449|Caenorhabditis elegans Hypothetical ... 28 5.9 AC025726-6|AAK73923.2| 238|Caenorhabditis elegans Hypothetical ... 28 5.9 >U41273-7|AAP68952.1| 237|Caenorhabditis elegans Hypothetical protein C26B9.1b protein. Length = 237 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 688 RFTGKL*IAFSGQY-NSVLPSPIVFPDVRAYGKSSYHPELCRSE 560 R L + +S +Y SV+ ++FP +G S+Y P+ C+++ Sbjct: 170 REAASLILKYSQEYVKSVVKKRLIFPSKPIHGVSNYAPKHCKTQ 213 >U41273-6|AAA82457.2| 404|Caenorhabditis elegans Hypothetical protein C26B9.1a protein. Length = 404 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 688 RFTGKL*IAFSGQY-NSVLPSPIVFPDVRAYGKSSYHPELCRSE 560 R L + +S +Y SV+ ++FP +G S+Y P+ C+++ Sbjct: 337 REAASLILKYSQEYVKSVVKKRLIFPSKPIHGVSNYAPKHCKTQ 380 >AL132876-7|CAD21659.1| 449|Caenorhabditis elegans Hypothetical protein Y105E8A.8 protein. Length = 449 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 2/82 (2%) Frame = -1 Query: 453 IPDLFQMG--HELLTLKNKKNIKRHTSSGHGFIAWYENIQRRSKNYTMQSNL*IYENKRT 280 +PDLF G L+ + + K + S+ G + Y N+ + L +Y ++R Sbjct: 275 MPDLFAAGGSSSLVAIYSLK-WRNAVSTIEGSLKGYTNL------HFSPDGLKLYASERK 327 Query: 279 HHLICYEIKLNQLSKLATRDMS 214 + C++ ++N L+++ RDM+ Sbjct: 328 GDIHCFDTRMNMLTQILKRDMT 349 >AC025726-6|AAK73923.2| 238|Caenorhabditis elegans Hypothetical protein Y71G12B.22 protein. Length = 238 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/69 (28%), Positives = 32/69 (46%) Frame = -1 Query: 423 LLTLKNKKNIKRHTSSGHGFIAWYENIQRRSKNYTMQSNL*IYENKRTHHLICYEIKLNQ 244 +L +KN + T HG E I +++YT Q ++ + H + +E+KL Sbjct: 22 VLGMKNHPEVIDLTQMSHGTSLILEKIMSGNRDYTTQISM--NQAAELCH-VAHELKLVN 78 Query: 243 LSKLATRDM 217 L KL DM Sbjct: 79 LLKLVEMDM 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,984,179 Number of Sequences: 27780 Number of extensions: 359044 Number of successful extensions: 780 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -