BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30227 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 0.90 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 3.6 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 4.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 4.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 4.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 4.8 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 8.4 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 26.2 bits (55), Expect = 0.90 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +3 Query: 399 PTDQAAVLSLVTKLQTVLDNIVVAPGEFAACQLEEVRQVGSYKKGTMMAGKNVADIVVI 575 PTD+ +L+T+ + VV G+F A +E + S K +++ D+VV+ Sbjct: 98 PTDEFERFIEAVQLETLTHSQVVIAGDFNAWHVEWGSERNSEKGEELLSAIQQLDLVVL 156 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.2 bits (50), Expect = 3.6 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 55 IRTLYKLARKNNQRKI--SENTTSMSLTFQVQN 147 +R LY LAR N +RKI S+ ++L +V+N Sbjct: 304 LRRLYILARSNLKRKIKASKRRCFLALCDEVEN 336 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 327 CKPAPDDSVLTQALLKRHTELCPSPTD 407 CK APD + +T+ L+ P+PTD Sbjct: 611 CK-APDQAAVTRPLMAADLGAGPAPTD 636 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 303 LAEPAFPRCKPAPDDSVLTQALLKRHTELCPSPTDQAAVLSLVTKLQTVL 452 +AEP PAP+ +L + + + C A +L +T + +L Sbjct: 103 IAEPKAASATPAPELELLRATIQRLEEQNCAMKEQNAKLLEQITGMCQLL 152 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 203 RSWWTRYPRPGRDGASTLQQTP 268 R+W RY + G TL++TP Sbjct: 1876 RTWGMRYEYDNQSGLLTLKRTP 1897 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 203 RSWWTRYPRPGRDGASTLQQTP 268 R+W RY + G TL++TP Sbjct: 1877 RTWGMRYEYDNQSGLLTLKRTP 1898 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 363 ALLKRHTELCPSPTDQAAVLSLVTKLQTV 449 A+LK+ T P D ++ V K QT+ Sbjct: 510 AMLKKGTNRVTGPLDSDVLIEYVRKRQTI 538 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,277 Number of Sequences: 2352 Number of extensions: 12952 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -