BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30223 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.9 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 6.8 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 6.8 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 401 ECLNPWRDDTEEEELA 448 + L W DD++EEEL+ Sbjct: 34 QMLGIWADDSDEEELS 49 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 433 FSVITPWVETFIIIRFICAIHN 368 + ITP ++ + I C +HN Sbjct: 312 YKYITPLIQKHLKIHDTCGVHN 333 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 383 YEPNDDECLNPWRDDTEEEELARAVQNAAITEG 481 ++P D+EC E R N+ IT G Sbjct: 199 WQPEDEECTEATAGAVVLETCQRNSNNSTITAG 231 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,024 Number of Sequences: 438 Number of extensions: 3785 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -