BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30220 (726 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC021961-1|AAH21961.1| 328|Homo sapiens Unknown (protein for IM... 31 3.2 AY049721-1|AAL06645.1| 2696|Homo sapiens androgen receptor assoc... 31 3.2 AF395588-1|AAL40694.1| 2696|Homo sapiens putative nuclear protei... 31 3.2 AF322907-1|AAK92049.1| 2596|Homo sapiens NSD1 protein. 31 3.2 AK097297-1|BAC04995.1| 261|Homo sapiens protein ( Homo sapiens ... 30 7.3 AK097424-1|BAC05045.1| 535|Homo sapiens protein ( Homo sapiens ... 30 9.7 >BC021961-1|AAH21961.1| 328|Homo sapiens Unknown (protein for IMAGE:3908832) protein. Length = 328 Score = 31.5 bits (68), Expect = 3.2 Identities = 21/91 (23%), Positives = 41/91 (45%) Frame = +1 Query: 175 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEE 354 + D+D + D + + D +E+I+ T N + + ++V +G ST E Sbjct: 161 DADVDSEMDPEQPVTEDESIEEIFEE---TQTNATCNYETKSENGVKVAMGSEQDSTPES 217 Query: 355 RNQAILDFVTKISVNTQTKDVAQKNLFDKLN 447 R+ A+ ++ T+T+ Q+N D N Sbjct: 218 RHGAVKSPFLPLAPQTETQKNKQRNEVDGSN 248 >AY049721-1|AAL06645.1| 2696|Homo sapiens androgen receptor associated coregulator 267-b protein. Length = 2696 Score = 31.5 bits (68), Expect = 3.2 Identities = 21/91 (23%), Positives = 41/91 (45%) Frame = +1 Query: 175 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEE 354 + D+D + D + + D +E+I+ T N + + ++V +G ST E Sbjct: 161 DADVDSEMDPEQPVTEDESIEEIFEE---TQTNATCNYETKSENGVKVAMGSEQDSTPES 217 Query: 355 RNQAILDFVTKISVNTQTKDVAQKNLFDKLN 447 R+ A+ ++ T+T+ Q+N D N Sbjct: 218 RHGAVKSPFLPLAPQTETQKNKQRNEVDGSN 248 >AF395588-1|AAL40694.1| 2696|Homo sapiens putative nuclear protein NSD1 protein. Length = 2696 Score = 31.5 bits (68), Expect = 3.2 Identities = 21/91 (23%), Positives = 41/91 (45%) Frame = +1 Query: 175 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEE 354 + D+D + D + + D +E+I+ T N + + ++V +G ST E Sbjct: 161 DADVDSEMDPEQPVTEDESIEEIFEE---TQTNATCNYETKSENGVKVAMGSEQDSTPES 217 Query: 355 RNQAILDFVTKISVNTQTKDVAQKNLFDKLN 447 R+ A+ ++ T+T+ Q+N D N Sbjct: 218 RHGAVKSPFLPLAPQTETQKNKQRNEVDGSN 248 >AF322907-1|AAK92049.1| 2596|Homo sapiens NSD1 protein. Length = 2596 Score = 31.5 bits (68), Expect = 3.2 Identities = 21/91 (23%), Positives = 41/91 (45%) Frame = +1 Query: 175 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEE 354 + D+D + D + + D +E+I+ T N + + ++V +G ST E Sbjct: 161 DADVDSEMDPEQPVTEDESIEEIFEE---TQTNATCNYETKSENGVKVAMGSEQDSTPES 217 Query: 355 RNQAILDFVTKISVNTQTKDVAQKNLFDKLN 447 R+ A+ ++ T+T+ Q+N D N Sbjct: 218 RHGAVKSPFLPLAPQTETQKNKQRNEVDGSN 248 >AK097297-1|BAC04995.1| 261|Homo sapiens protein ( Homo sapiens cDNA FLJ39978 fis, clone SPLEN2029380. ). Length = 261 Score = 30.3 bits (65), Expect = 7.3 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -3 Query: 175 LLLYFGFSCPFSLVSFCHLFQASFFPWPLIFLTSCLPSPIFFPACINFQYFL-ILSLSL 2 L LY G FS VS C P I L++CL + +F P C F Y + LS+ L Sbjct: 29 LCLYLGICLTFS-VSLC----------PCIVLSACLSASLFLPPCCVFHYIVAFLSIFL 76 >AK097424-1|BAC05045.1| 535|Homo sapiens protein ( Homo sapiens cDNA FLJ40105 fis, clone TESTI2006383. ). Length = 535 Score = 29.9 bits (64), Expect = 9.7 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +1 Query: 289 KIALQKFLEVELGISAKSTIEERNQAILDFVTKISVNTQTKDVAQKNLFDKL 444 K+ +K +EVEL + +EE N + VT++ T+ D ++ + D+L Sbjct: 308 KLEREKAIEVELLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRL 359 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.316 0.135 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,585,487 Number of Sequences: 237096 Number of extensions: 1448806 Number of successful extensions: 2906 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2877 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8567175942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -