BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30199 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0908 - 21476700-21476945,21477638-21477935,21478078-214783... 28 5.4 07_03_1382 - 26170563-26170631,26171151-26171843 27 9.5 >10_08_0908 - 21476700-21476945,21477638-21477935,21478078-21478325, 21479319-21479573 Length = 348 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 511 IHLRSVCGLPANKEATWVSLNSFSNI*LINSGPS-EILN 624 + + V GL NK+ W S+N+ + ++N G + EIL+ Sbjct: 232 LQVNDVQGLQINKDGKWFSVNALNGALIVNIGDTLEILS 270 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 486 WYHGRLDRYTSEERLWAASKQGSYLG 563 WYH ++ + +ER + A+K + LG Sbjct: 158 WYHAGMEAFFDDERQYEAAKAAAQLG 183 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,700,226 Number of Sequences: 37544 Number of extensions: 266700 Number of successful extensions: 479 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -