BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30195 (563 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5BLD0 Cluster: Zgc:113210; n=4; Danio rerio|Rep: Zgc:1... 33 6.1 >UniRef50_Q5BLD0 Cluster: Zgc:113210; n=4; Danio rerio|Rep: Zgc:113210 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 707 Score = 32.7 bits (71), Expect = 6.1 Identities = 20/72 (27%), Positives = 37/72 (51%) Frame = -2 Query: 502 TLLTSSSDXVGANKVIELREILSTPITFVVLEQFRNLLLTLANKNE*QFLGRRHRSSRRL 323 T LTS + + V+E+ ++ + +++ LE R + K + +FL +S+R+ Sbjct: 11 TQLTSIMETLAKTAVVEISKLFANNSSYLRLEISRFTSENESLKKKCRFLESELQSARKT 70 Query: 322 VGKCDGVHAPPS 287 GK +G AP S Sbjct: 71 AGKMNGTEAPLS 82 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,705,573 Number of Sequences: 1657284 Number of extensions: 9316974 Number of successful extensions: 20995 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 20590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20993 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37904934977 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -