BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30195 (563 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 1.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 3.2 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 5.5 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +2 Query: 11 AHLVLSGNRSPREIYNVNAANYPTPDRQMALLYKNQLAS*LYVTLWHII 157 AH+V G+R+P EI A+ + ++A ++ + L+ WH++ Sbjct: 166 AHIVPEGSRTPIEIPQDFTASDLDEEHRVA-YWREDIGLNLHHWHWHLV 213 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 3.2 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 339 RCLRPKNCHSFLFANVKRRFLNCSKTTNVIGVLNISLSSI 458 R RP NC L+A + + C K L+ SL + Sbjct: 712 RLARPANCSPDLYAVMLNCWKECPKNRPTFTELSKSLEGL 751 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 5.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 361 QFLGRRHRSSRRLVGKCDGVHAPPSXKLCRSTRLAEFRRR 242 Q G+R RS+ R + H P S + R E R+R Sbjct: 6 QEFGKRGRSTGRGLKYSGQQHGPQSDSRNQQLRTGEKRKR 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,188 Number of Sequences: 336 Number of extensions: 2253 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -