BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30194 (400 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 0.97 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 3.0 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 3.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 3.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 3.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 3.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 3.9 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 5.2 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 21 5.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.9 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 20 9.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 20 9.1 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 20 9.1 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 20 9.1 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.4 bits (48), Expect = 0.97 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 42 NTSKWLIEEQNYASTSSERTARP 110 +T +WL+ E+ TSS + P Sbjct: 72 STGEWLLTEEKLPKTSSNASVEP 94 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 3.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 301 PPNRSRYLLPSLSYNHC 251 PPNR +P +YN C Sbjct: 1648 PPNRKLPPVPGSNYNTC 1664 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 3.9 Identities = 10/38 (26%), Positives = 16/38 (42%) Frame = +3 Query: 111 KCRRRDFVPRPYTGPSYQQVEQMKGVYMPPSITNAYKK 224 KC R F P+ YQ + ++ S +A +K Sbjct: 415 KCEHRPFEPKSTAVQKYQDQDYQPIYFVADSFEDAKEK 452 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 3.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 221 EAGASHPGAHAVVIRQRRQEIPGSVRWN 304 + AS PG +V E+PGS W+ Sbjct: 403 DVAASGPGLAFLVYPSAVLELPGSSIWS 430 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 13 VTYCNRLNRETHRNG 57 VT C N ET+R G Sbjct: 562 VTKCKATNEETYRGG 576 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 13 VTYCNRLNRETHRNG 57 VT C N ET+R G Sbjct: 562 VTKCKATNEETYRGG 576 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 13 VTYCNRLNRETHRNG 57 VT C N ET+R G Sbjct: 562 VTKCKATNEETYRGG 576 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.0 bits (42), Expect = 5.2 Identities = 8/27 (29%), Positives = 11/27 (40%) Frame = -3 Query: 383 RMPQYIELIFEGCIYFRMTMAHGDGDD 303 R P Y + Y++ HG G D Sbjct: 79 RFPPYNRMDMRNATYYQHQQDHGSGMD 105 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 21.0 bits (42), Expect = 5.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 104 TAKMPPTGFRAQTVH 148 T M PTGFR VH Sbjct: 65 TRHMLPTGFRKVLVH 79 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 239 GEKHRLLIG 213 G+KH+LLIG Sbjct: 184 GQKHKLLIG 192 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 152 SRVRSGHEIPSAAFWPCCT 96 +RVR G + F PC T Sbjct: 106 TRVRCGRSLEGYPFNPCLT 124 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 318 VGHCHPKVNAALKDQL 365 + + HPK A L DQ+ Sbjct: 199 IDYVHPKDKATLADQI 214 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 20.2 bits (40), Expect = 9.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 152 SRVRSGHEIPSAAFWPCCT 96 +RVR G + F PC T Sbjct: 122 TRVRCGRSLEGYPFNPCLT 140 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 318 VGHCHPKVNAALKDQL 365 + + HPK A L DQ+ Sbjct: 194 IDYVHPKDKATLADQI 209 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,062 Number of Sequences: 438 Number of extensions: 2972 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -