BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30191 (534 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 28 1.0 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 26 3.1 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 5.4 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 25 5.4 SPCC126.06 |twf1||twinfilin|Schizosaccharomyces pombe|chr 3|||Ma... 25 5.4 >SPBC1604.19c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 27.9 bits (59), Expect = 1.0 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 295 SLARLSDGSKNVLLLFQNFHNHVEPLWRARYV*RARSEFSCI*IFVVL 438 S SD +K + + +N P WR+ +A SE SC+ ++ +L Sbjct: 314 SFCSSSDDAKPITFVTKNLRKFPIPEWRSSLEVQAESEQSCLPLYPLL 361 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 26.2 bits (55), Expect = 3.1 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 58 CRTHLNIDISNAHCGPWRHIQDHSCLRAGC---IKNINHIAWLVP 183 C +N S CG H+ SC+R C I+ N AW P Sbjct: 200 CTDTINPSTSIWSCGTCYHVFHLSCIRKWCKNSIEQRNEDAWRCP 244 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 25.4 bits (53), Expect = 5.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 268 PKTTITNRVSLARLSDGSKNVLLLFQNFHNHVEP 369 PKT +T +S + S S +L QNF+N P Sbjct: 577 PKTNLTRSLSYSEQSFDSGVSILSCQNFYNIFHP 610 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 25.4 bits (53), Expect = 5.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 338 YFKIFIITSNLSGARVMFSVRVASSRVYEFLSSWFR 445 + K+ T ++ R+ F + YE LSSW+R Sbjct: 965 FTKVITKTFSIKSIRLQFLSLIIYEITYEQLSSWYR 1000 >SPCC126.06 |twf1||twinfilin|Schizosaccharomyces pombe|chr 3|||Manual Length = 328 Score = 25.4 bits (53), Expect = 5.4 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 60 QDTFEHRHFERTLRSVETHPGPLLSEG 140 QD E + + +++S TH PL++ G Sbjct: 147 QDELERKEYNESMQSSVTHKRPLVTRG 173 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,894,262 Number of Sequences: 5004 Number of extensions: 33302 Number of successful extensions: 84 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -