BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30189 (776 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0898 + 6908826-6908974,6909059-6909428,6909510-6909929,691... 30 1.8 12_01_1101 - 11602534-11603460,11615583-11615680,11615712-11616189 28 7.2 >06_01_0898 + 6908826-6908974,6909059-6909428,6909510-6909929, 6910017-6910315,6910390-6910648,6910732-6911041, 6911126-6911251,6911373-6911417,6911652-6911702, 6912041-6912153 Length = 713 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 243 LN*INMTELSLFCRYNIKQLLE-KYNFFDKLTLGPIVPLCRLFGALA 380 L+ + ELS FC +QLL+ F ++L ++PLCRL LA Sbjct: 21 LSAVEGAELSTFCPRLSRQLLQIDPRFVERLREAGLIPLCRLVEDLA 67 >12_01_1101 - 11602534-11603460,11615583-11615680,11615712-11616189 Length = 500 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 211 FFMTLSRKT-IVCKRTLQTIIIIILGDPADFV-VPP 110 F + LS T I+C+ L ++I+++LG DF+ PP Sbjct: 165 FLLWLSTGTRILCRERLSSLILLVLGVGVDFINFPP 200 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,473,595 Number of Sequences: 37544 Number of extensions: 281515 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -