BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30189 (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) 32 0.60 SB_36915| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 9.7 >SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) Length = 452 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 342 PIVPLCRLFGALACALRLKRNVTLFRACSRCSLIFKTLSRQKR 470 P + + +GALAC LRL+ V+ C +C + LS+ KR Sbjct: 221 PGIIMVAAYGALACKLRLR--VSTRMRCDKCKTNLRPLSKNKR 261 >SB_36915| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 304 Score = 27.9 bits (59), Expect = 9.7 Identities = 22/87 (25%), Positives = 41/87 (47%) Frame = +3 Query: 267 LSLFCRYNIKQLLEKYNFFDKLTLGPIVPLCRLFGALACALRLKRNVTLFRACSRCSLIF 446 L LF + ++ L K F+ LTL + C + A A+ +R + LFR + SL+ Sbjct: 88 LPLFTGFLLEHSLFKSCFYYGLTLSTALLTCGVSFATIVAISCERYLALFRPFTYLSLV- 146 Query: 447 KTLSRQKRCFLKTEFLQCIIDITEFIY 527 T+ R C + ++ + + F++ Sbjct: 147 -TVPR-VGCAIAISWILSSVIVATFVF 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,326,975 Number of Sequences: 59808 Number of extensions: 369132 Number of successful extensions: 679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -