Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30189
         (776 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    27   0.19 
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   9.7  

>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 27.1 bits (57), Expect = 0.19
 Identities = 14/51 (27%), Positives = 22/51 (43%)
 Frame = -2

Query: 448 LKINEHRLHARKSVTFRLSLSAQARAPNKRQRGTIGPRVNLSKKLYFSSNC 296
           L+  EHR  + K +T +       R+  KR         N+S  +Y + NC
Sbjct: 595 LEKREHRSSSTKGITIQEPPQWHTRSTEKRVSAGTPAAFNISTTIYENQNC 645


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 714  YHKKVHAHCRGHR 676
            YH  V+ HC  HR
Sbjct: 1679 YHHNVNKHCTIHR 1691


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 198,682
Number of Sequences: 438
Number of extensions: 4129
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24396777
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)