BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30179 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71240.1 68414.m08222 expressed protein contains Pfam profile... 31 0.98 At5g25540.1 68418.m03039 expressed protein 29 3.0 At5g59200.1 68418.m07419 pentatricopeptide (PPR) repeat-containi... 28 5.2 At4g28650.1 68417.m04095 leucine-rich repeat transmembrane prote... 28 5.2 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 28 5.2 At5g11440.1 68418.m01336 hypothetical protein 28 6.9 At3g57940.1 68416.m06458 expressed protein contains Pfam profile... 28 6.9 At5g59150.1 68418.m07413 Ras-related GTP-binding protein, putati... 27 9.1 At3g46830.1 68416.m05083 Ras-related protein (RAB11A) / small GT... 27 9.1 At1g80840.1 68414.m09484 WRKY family transcription factor simila... 27 9.1 At1g67220.1 68414.m07651 zinc finger protein-related similar to ... 27 9.1 >At1g71240.1 68414.m08222 expressed protein contains Pfam profile: PF04842 plant protein of unknown function (DUF639) Length = 824 Score = 30.7 bits (66), Expect = 0.98 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +2 Query: 428 VLGDLDIP-KVKKQSLQHLKSSVEEDFQFLSELAAL-KAVTEKVESGAISADNIIDF--Y 595 +L D+ P K K QSL+ + ++DF+ L EL + + V G +S D II + Sbjct: 81 ILSDVTSPLKKKSQSLKKIDLEDQQDFEDLEELLTVEQTVRSDTPKGFLSFDAIISIEQF 140 Query: 596 NLRINSL 616 + R+N + Sbjct: 141 SSRMNGI 147 >At5g25540.1 68418.m03039 expressed protein Length = 175 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +2 Query: 185 LLITDPFNTPEAVVEVYISGISSLGSSADFKSKK--YPLVVDEYEPDTFDV 331 LL T P + E++ +VY++ L ++ + ++ Y +EY PDT D+ Sbjct: 91 LLATYPGLSQESINDVYLANTCDLDATIEMLNQLEIYSTEAEEYLPDTLDI 141 >At5g59200.1 68418.m07419 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 590 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +2 Query: 131 IFSASLGLSVEENSEWNGLLITDPFNTPEAVVE-VYISGISSL-GSSADFK 277 IF LGL ++ + W GL+IT+ N E+ +E IS ++++ G + F+ Sbjct: 12 IFINELGLLLQAHFTWIGLIITENCNGLESSIEREMISSLAAITGGPSTFR 62 >At4g28650.1 68417.m04095 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase 5, Arabidopsis thaliana, PIR1:S27756 Length = 1013 Score = 28.3 bits (60), Expect = 5.2 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 2/185 (1%) Frame = +2 Query: 29 IIGINASGELS--ILHSPESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDP 202 + G+N +G++S I +SF+ S FESLL + + + +NS L + Sbjct: 78 LAGMNLTGKISDSISQLSSLVSFNISCNGFESLLPKSIPPLKSIDISQNSFSGSLFLFS- 136 Query: 203 FNTPEAVVEVYISGISSLGSSADFKSKKYPLVVDEYEPDTFDVLKHRINQRFTNGGNKLV 382 N +V + SG + G+ + L V + + F + + F N KL Sbjct: 137 -NESLGLVHLNASGNNLSGNLTEDLGNLVSLEVLDLRGNFF---QGSLPSSFKN-LQKLR 191 Query: 383 NINLSDSDQLLSYSNVLGDLDIPKVKKQSLQHLKSSVEEDFQFLSELAALKAVTEKVESG 562 + LS ++ +VLG L + K + +F ++ L L K+ SG Sbjct: 192 FLGLSGNNLTGELPSVLGQLPSLETAILGYNEFKGPIPPEFGNINSLKYLDLAIGKL-SG 250 Query: 563 AISAD 577 I ++ Sbjct: 251 EIPSE 255 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +2 Query: 113 ESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPEAVVE 229 E LL+ + LG EE +E N +L TDP TP+A+ E Sbjct: 70 EDLLRYVVYTGLGW--EEGNEGN-ILFTDPLCTPKAIRE 105 >At5g11440.1 68418.m01336 hypothetical protein Length = 155 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 2/86 (2%) Frame = +2 Query: 80 SLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPEAVVEVYISGISSLG 259 ++ S K+ E K+I L L ++ + + LL+T + E++ +VY++ L Sbjct: 39 TVEVSMPKKSSEMAYKQIRDDDLDLEMDIDMDIEYLLVTFSGLSQESITDVYLANGGDLE 98 Query: 260 SSADFKSKK--YPLVVDEYEPDTFDV 331 ++ + ++ Y +E P+T D+ Sbjct: 99 ATIEMLNQLEIYSTESEENLPETLDI 124 >At3g57940.1 68416.m06458 expressed protein contains Pfam profile PF05127: Putative ATPase (DUF699) Length = 1024 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 35 GINASGELSILHSPESLSFSGSSKTFESL-LKEIFSASLGLSVEENSEWNGLLITD 199 G+ S ++++HSP+SL F + F+ + L E G +E S NGLL D Sbjct: 440 GLEGSVLVNVIHSPDSLKFLRTGCLFKKIELTESIRYGSGDPIE--SWLNGLLCLD 493 >At5g59150.1 68418.m07413 Ras-related GTP-binding protein, putative similar to Ras-related protein Rab11C SP:Q40193 from [Lotus japonicus] Length = 217 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 461 KQSLQHLKSSVEEDFQFLSELAALKAVTEKVESGAISADNI 583 K L HL+S EED Q L+E L +E+ A+ A N+ Sbjct: 126 KADLNHLRSVAEEDGQTLAETEGLSF----LETSALEATNV 162 >At3g46830.1 68416.m05083 Ras-related protein (RAB11A) / small GTP-binding protein, putative identical to SP|Q96283 Ras-related protein Rab11A {Arabidopsis thaliana}; identical to cDNA Rab11 protein GI:2598228 Length = 217 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 461 KQSLQHLKSSVEEDFQFLSELAALKAVTEKVESGAISADNI 583 K L HL+S EED Q L+E L +E+ A+ A N+ Sbjct: 126 KSDLNHLRSVAEEDGQSLAEKEGLSF----LETSALEATNV 162 >At1g80840.1 68414.m09484 WRKY family transcription factor similar to WRKY transcription factor GB:BAA87058 GI:6472585 from [Nicotiana tabacum] Length = 302 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 440 LDIPKVKKQSLQHLKSSVEEDFQFLSELAALKAVTEKV 553 +D P+V+K ++ + SS+ +D F + LAA AVT K+ Sbjct: 259 IDFPQVQKLLVEQMASSLTKDPNFTAALAA--AVTGKL 294 >At1g67220.1 68414.m07651 zinc finger protein-related similar to SP|Q09472 E1A-associated protein p300 {Homo sapiens}, SP|Q92793 CREB-binding protein {Homo sapiens}; contains Pfam profiles PF00569: Zinc finger ZZ type, PF00628: PHD-finger, PF02135: TAZ zinc finger Length = 1357 Score = 27.5 bits (58), Expect = 9.1 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = -2 Query: 228 STTASGVLNGSVINNPFHSEFSSTERPR--EAENISFKRLSKVLLEPEKLNDSGLWRMLS 55 +T + N + N P S +S E + E+ KR K EP KLN W +L Sbjct: 17 NTESFDEFNQRLNNLPAESNVTSDEDAQFLESRKCQSKRWRKE--EPLKLNLRSPWNVLC 74 Query: 54 SPEALIPIIEEIKKT 10 SPE++ ++KT Sbjct: 75 SPESISSAKFIVEKT 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,996,607 Number of Sequences: 28952 Number of extensions: 277490 Number of successful extensions: 942 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -