BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30177 (723 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2EER3 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_Q8M9T2 Cluster: Putative membrane protein ycf1; n=1; Ch... 35 2.3 UniRef50_Q8IBY8 Cluster: Putative uncharacterized protein PF07_0... 34 4.1 UniRef50_UPI00006CD129 Cluster: TPR Domain containing protein; n... 33 5.4 UniRef50_Q03DM1 Cluster: ABC-type multidrug transport system, pe... 33 5.4 UniRef50_Q4YK16 Cluster: Reticulocyte binding protein, putative;... 33 5.4 UniRef50_A0GWH4 Cluster: Lipopolysaccharide biosynthesis; n=2; C... 33 7.1 UniRef50_UPI0000E24C21 Cluster: PREDICTED: similar to breast can... 33 9.4 UniRef50_Q54PJ4 Cluster: Putative uncharacterized protein; n=1; ... 33 9.4 UniRef50_A5E532 Cluster: Exocyst complex component EXO84; n=1; L... 33 9.4 >UniRef50_A2EER3 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 663 Score = 34.7 bits (76), Expect = 2.3 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = -2 Query: 368 YVINTKNIQFVKKILLSYIFSLSID*NFCYKI*N-GLITLFDCTF--CTNSQLYLKEFL* 198 + + + NI+FV +L +Y F +D CY N LF TF C++ LY+ EF+ Sbjct: 238 FAVASHNIEFVTYLLNNYTF--DVDLRICYNYNNLQSFLLFIDTFKLCSSGLLYISEFMG 295 Query: 197 SNFL 186 +N L Sbjct: 296 NNIL 299 >UniRef50_Q8M9T2 Cluster: Putative membrane protein ycf1; n=1; Chaetosphaeridium globosum|Rep: Putative membrane protein ycf1 - Chaetosphaeridium globosum Length = 1450 Score = 34.7 bits (76), Expect = 2.3 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 11/145 (7%) Frame = +3 Query: 117 NVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEERNQAI------LDF 278 N IL EK++N + + N IEK I +K ++ I K + N++I LDF Sbjct: 877 NTIILFEKVFNKKRINEDNKTIEKSILNKKNEQL---ILKKDEVIPNNKSIAGKLSKLDF 933 Query: 279 ----VTKISVNTQTKDVAQKNLFDKLNILGVNYXXXXXXXXXXXXGSDELNKITNPLINT 446 +TK S+ TK + KN ++ L L N + LNK+ LI Sbjct: 934 HNQNITKTSIKNATKQILIKNEYNSL--LKENKNLFTKNKIVFLKIKNILNKLNLKLIKV 991 Query: 447 -VDQTVKEKTYLVQAALNALTGFYA 518 ++ T K KT L + N L FY+ Sbjct: 992 KINFTYKIKTVLKIISRNLLK-FYS 1015 >UniRef50_Q8IBY8 Cluster: Putative uncharacterized protein PF07_0042; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PF07_0042 - Plasmodium falciparum (isolate 3D7) Length = 2910 Score = 33.9 bits (74), Expect = 4.1 Identities = 16/60 (26%), Positives = 33/60 (55%) Frame = +3 Query: 72 VNVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIE 251 +N+ +D ++ NE LN+ + EK+ N + L + E+ + LE + G++ K T++ Sbjct: 2006 LNILLDQNKKINEELNIQVEQEKLINNEIIVQLKKENEENNKINSLLEEQNGLNKKVTLQ 2065 >UniRef50_UPI00006CD129 Cluster: TPR Domain containing protein; n=2; Tetrahymena thermophila SB210|Rep: TPR Domain containing protein - Tetrahymena thermophila SB210 Length = 878 Score = 33.5 bits (73), Expect = 5.4 Identities = 15/40 (37%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = -2 Query: 224 QLYLKEFL*SNFLFYVSIQIS*TVAI-VDFFNKNIDIQEF 108 +L +K++ F+F S+QI T+ I +DFF++NI++ +F Sbjct: 674 KLSIKQYFIDEFIFNSSVQIELTLLIQMDFFSQNINLSQF 713 >UniRef50_Q03DM1 Cluster: ABC-type multidrug transport system, permease component; n=16; Bacilli|Rep: ABC-type multidrug transport system, permease component - Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) Length = 380 Score = 33.5 bits (73), Expect = 5.4 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Frame = +3 Query: 123 DILVEKIYNGYGLTDLNTDIEK----KIALQKFLEVELGISAKSTIEERNQAILDFVTKI 290 D ++EK N + +T NTD K K+A + + V K +E+ N+A+ + TK+ Sbjct: 89 DTIIEKDGNNFNITYANTDATKTATTKMAFKNAVTVNNIKQLKKHLEQSNRALNELQTKL 148 Query: 291 SVNTQTKDVAQKNL 332 ++ T+ K V K++ Sbjct: 149 ALVTK-KSVKTKSM 161 >UniRef50_Q4YK16 Cluster: Reticulocyte binding protein, putative; n=4; Plasmodium|Rep: Reticulocyte binding protein, putative - Plasmodium berghei Length = 391 Score = 33.5 bits (73), Expect = 5.4 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 1/98 (1%) Frame = +3 Query: 207 FLEVELGISAKSTIEERNQAILDFVTKISVNTQTKDVAQKNLFDK-LNILGVNYXXXXXX 383 +L++ L IS IE+ N+ IL+F+ S++ + KD +LF K +N G N Sbjct: 199 YLKIILNISDNYGIEKNNECILNFL--YSIDLKIKDFL--SLFTKNMNKSGNN------N 248 Query: 384 XXXXXXGSDELNKITNPLINTVDQTVKEKTYLVQAALN 497 ++ KI N L VD K+K +++ A+N Sbjct: 249 KNLNLSNNERYKKIENVLFKNVDLDEKDKYNIIKEAIN 286 >UniRef50_A0GWH4 Cluster: Lipopolysaccharide biosynthesis; n=2; Chloroflexus|Rep: Lipopolysaccharide biosynthesis - Chloroflexus aggregans DSM 9485 Length = 349 Score = 33.1 bits (72), Expect = 7.1 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = +3 Query: 168 LNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFVT 284 LNTD ++ +A QKF E +L ++ +++ QA++DF++ Sbjct: 159 LNTDFQESVAAQKFFE-DLIAPYQADVDQARQALIDFLS 196 >UniRef50_UPI0000E24C21 Cluster: PREDICTED: similar to breast cancer antigen NY-BR-1; n=1; Pan troglodytes|Rep: PREDICTED: similar to breast cancer antigen NY-BR-1 - Pan troglodytes Length = 532 Score = 32.7 bits (71), Expect = 9.4 Identities = 25/93 (26%), Positives = 43/93 (46%) Frame = +3 Query: 75 NVDIDIDQDSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEE 254 +V + ++Q+ + NVDIL EKI L +E K L++ L ++ I KS Sbjct: 299 SVRLTLNQEEEKRKNVDILKEKIRPE---EQLRKKLEVKQQLEQALRIQ-DIELKSVTSN 354 Query: 255 RNQAILDFVTKISVNTQTKDVAQKNLFDKLNIL 353 NQ I +++ + V + F+ + IL Sbjct: 355 LNQEIAMLKLEVATLKRQHQVKENKYFEDIKIL 387 >UniRef50_Q54PJ4 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1458 Score = 32.7 bits (71), Expect = 9.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 577 HHHHGMLQHQNLTHRLRPT*ILKLQRQRYQH 669 HHHH QHQN H+ + L Q+Q++ H Sbjct: 949 HHHHHQQQHQNQQHQKQQNHQLHHQQQQHHH 979 >UniRef50_A5E532 Cluster: Exocyst complex component EXO84; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Exocyst complex component EXO84 - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 812 Score = 32.7 bits (71), Expect = 9.4 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +3 Query: 108 EFLNVDILVEKIYNGYG-LTDLNTDIEKKIA-LQKFLEVELGISAKSTIEERNQAILDFV 281 EF +VDI + + N + L T IEK++ + +L + SA S + ++++L V Sbjct: 557 EFDDVDINISR--NKFADAVQLVTAIEKRLLKFENYLAKQRN-SASSLANQTDESLLLEV 613 Query: 282 TKISVNTQTKDVAQKNLFDKLN 347 TK+ V + ++ Q LFD LN Sbjct: 614 TKLKVENRKDEIIQCLLFDLLN 635 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,418,165 Number of Sequences: 1657284 Number of extensions: 8764197 Number of successful extensions: 23502 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 22301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23351 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 58677691418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -