BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30177 (723 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060444-1|AAL25483.1| 162|Drosophila melanogaster LD47606p pro... 29 4.8 AE014296-1228|AAF50580.1| 162|Drosophila melanogaster CG8600-PA... 29 4.8 >AY060444-1|AAL25483.1| 162|Drosophila melanogaster LD47606p protein. Length = 162 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 577 HHHHGMLQHQNLTHRLRPT*ILKLQRQRYQHLDAEKSETN 696 HHHH QHQ T L QRQR ++++ +K E++ Sbjct: 124 HHHHHQQQHQRPPRPEGRT--LHQQRQREEYVELQKRESD 161 >AE014296-1228|AAF50580.1| 162|Drosophila melanogaster CG8600-PA protein. Length = 162 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 577 HHHHGMLQHQNLTHRLRPT*ILKLQRQRYQHLDAEKSETN 696 HHHH QHQ T L QRQR ++++ +K E++ Sbjct: 124 HHHHHQQQHQRPPRPEGRT--LHQQRQREEYVELQKRESD 161 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,015,837 Number of Sequences: 53049 Number of extensions: 410979 Number of successful extensions: 1627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1595 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3231892257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -