BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30176 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 4.4 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 5.8 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 5.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 99 NQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEA 221 N+I + W + D G AYHGD + E I ++A Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 646 QTKPTASTTRLYTTSASAL 702 QTK T STT TT+ S L Sbjct: 1184 QTKTTTSTTTRPTTTVSQL 1202 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 320 RTEDLSERSGADRVHGAGLQVDEDGAG 240 + DLS R+G+ H L + + G G Sbjct: 196 KARDLSPRNGSPTDHSPVLNLSKSGGG 222 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 649 TKPTASTTRLYTTSASALSNCP 714 +K + STT TT++SAL++ P Sbjct: 4 SKFSPSTTTTTTTTSSALNSTP 25 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 649 TKPTASTTRLYTTSASALSNCP 714 +K + STT TT++SAL++ P Sbjct: 4 SKFSPSTTTTTTTTSSALNSTP 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,090 Number of Sequences: 336 Number of extensions: 3610 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -