BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30175 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_58187| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/78 (19%), Positives = 40/78 (51%) Frame = +3 Query: 111 LTKTVRVSLKMTRESAKNVEKGSCQVSDILEVFGRYQIFQYVLICLPSVFVTMIDINYVF 290 +TK V+ ++ K KG + + + R+ +++Y+ + S+ ++ IDI+ Sbjct: 1656 VTKGVKPEPSQMKDIIK-CAKGEYRYIEYRYIKYRHILYRYIKYRISSIVISSIDISCYI 1714 Query: 291 VAGDLEYR*VQFKKVSFQ 344 +EYR ++++ + ++ Sbjct: 1715 KYRYIEYRYIEYRYIEYR 1732 >SB_58187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 222 IFQYVLICLPSVFVTMIDINYVFVAGDLEY 311 + QY L CLP +T+I + V AG+ Y Sbjct: 20 VIQYCLFCLPLCVLTVIRLCEVSKAGETHY 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,341,560 Number of Sequences: 59808 Number of extensions: 253320 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -