BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30172 (791 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.8 SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 27 3.1 SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual 27 4.1 SPBC19C7.06 |||proline-tRNA ligase |Schizosaccharomyces pombe|ch... 26 5.4 SPAC29E6.10c ||SPAC30.14c|kinetochore protein |Schizosaccharomyc... 26 7.1 SPAC4G9.13c |vps26|pep8|retromer complex subunit Vps26|Schizosac... 26 7.1 SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe... 25 9.4 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 27.9 bits (59), Expect = 1.8 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 3/92 (3%) Frame = -2 Query: 487 RLYFL--H*FPTLPQGIFVKQFSFLCQYSNQLNRSHCRFFQQEYRHSRIH*NPGLYQYPH 314 RL+F+ FP L IF +F+ +S+ L S R + Y H + + Sbjct: 20 RLFFVCSFFFPLLYSFIFATLHAFVFLFSHTLVSSQFRRLKLPYHHHHTFTIEAFFYWFF 79 Query: 313 LLLYFGFSC-PFSLVSFCHLFQASFFPWPLIF 221 +F C F + F H + ++ P+ F Sbjct: 80 FFFFFFSHCRRFHIAIFIHPYDSNVVPFFCFF 111 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 379 IYNGYGLTDLNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFV 519 I+ Y L ++ DI + + K ++EL + S + NQ + DF+ Sbjct: 1201 IFQAYLLKEMPNDIVSQFEMLKSKQIELTVQMASYEGDLNQNLCDFL 1247 >SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 295 FSCPFSLVSFCHLFQASFFPWPLIFLTSCLPS 200 F+ F+ V+F + + +F W L+FL LP+ Sbjct: 722 FAQTFAFVTFNKVCTSQYFMWYLVFLPLVLPN 753 >SPBC19C7.06 |||proline-tRNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 716 Score = 26.2 bits (55), Expect = 5.4 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +1 Query: 403 DLNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFVTKISVNTQTKDV 555 D + IAL + + V GI+ K+T +ERN+ I F +K++ D+ Sbjct: 487 DKGLKLPPAIALVQSVVVPCGITNKTTDQERNE-IEGFCSKLADRLNAADI 536 >SPAC29E6.10c ||SPAC30.14c|kinetochore protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 25.8 bits (54), Expect = 7.1 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 406 LNTDIEKKIALQKFLEVELGISAKSTIEERNQAILDFVTKISVNTQT 546 LN DI + +V+ + +++EE+N +FVT IS QT Sbjct: 374 LNDDITQDELNSSNADVDEEVIETTSLEEKNVDNQEFVTSISNGNQT 420 >SPAC4G9.13c |vps26|pep8|retromer complex subunit Vps26|Schizosaccharomyces pombe|chr 1|||Manual Length = 298 Score = 25.8 bits (54), Expect = 7.1 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 337 DSNEFLNVDILVEKIYNGYGLTDLNTDIEKKIALQKFLEVEL 462 D N I + NGY LT D+ KK +++ +L + L Sbjct: 233 DGNPNRGETIPLRMFLNGYALTPTFRDVNKKFSVRYYLSLIL 274 >SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1465 Score = 25.4 bits (53), Expect = 9.4 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -2 Query: 484 LYFLH*FPTLPQGIFVKQFSFLCQ--YSNQLNRSHCRFFQQEYRHSRIH*NPGLYQYPHL 311 +Y+++ F + G+ + F F+ N + + +E S NP Y Y + Sbjct: 890 VYWMY-FKSCSIGLILLYFFFIISGIMMNVATNVWLKHWSEENGKSSSELNPSPYFYLGI 948 Query: 310 LLYFGF-SCPF 281 L+FGF SC F Sbjct: 949 YLFFGFLSCAF 959 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.312 0.133 0.356 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,069,457 Number of Sequences: 5004 Number of extensions: 38572 Number of successful extensions: 85 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -