BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30166 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 25 0.72 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.96 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.7 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.9 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 6.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 6.7 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 8.9 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 8.9 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 25.0 bits (52), Expect = 0.72 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +2 Query: 410 EVPKDTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQTDYKNKIKKDV 589 E+ K K E ++ +I +A +EPT +RQT + V +L A+ KK + Sbjct: 162 EIQKXIKKAKEDVIEVIQKAHNMELEPTPGNTLRQTFENQVNRILNDARDKTGGSAKKSL 221 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.6 bits (51), Expect = 0.96 Identities = 7/27 (25%), Positives = 20/27 (74%) Frame = +2 Query: 527 LVESLLGKAQTDYKNKIKKDVVLKVDT 607 +V+++ G +KN++++++ +K+DT Sbjct: 58 IVKAISGVQTVRFKNELERNITIKLDT 84 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = -2 Query: 224 FRC*TPPRPSHRFLRP----FRWPL 162 FRC PP P RF+ P FR PL Sbjct: 148 FRCIGPPTPFPRFIPPNAYRFRPPL 172 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 574 LILVVCLGFSEQGL 533 L+LVVCLG + QG+ Sbjct: 5 LLLVVCLGIACQGI 18 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 661 PGCNQLDSTTGVGRQKVL-GVDFQHNIL 581 PG Q+DS+T GR+ ++F N L Sbjct: 530 PGKIQMDSSTNFGREDFWNSINFNENKL 557 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 661 PGCNQLDSTTGVGRQKVL-GVDFQHNIL 581 PG Q+DS+T GR+ ++F N L Sbjct: 530 PGKIQMDSSTNFGREDFWNSINFNENKL 557 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 8.9 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 4/29 (13%) Frame = -3 Query: 718 LLGDQLQARLQSVAD--LDT--SPGCNQL 644 LL DQLQ R QSV L T S CN++ Sbjct: 98 LLPDQLQERAQSVMGKCLPTSGSDNCNKI 126 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 8.9 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 4/29 (13%) Frame = -3 Query: 718 LLGDQLQARLQSVAD--LDT--SPGCNQL 644 LL DQLQ R QSV L T S CN++ Sbjct: 98 LLPDQLQERAQSVMGKCLPTSGSDNCNKI 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,162 Number of Sequences: 438 Number of extensions: 3358 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -