BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30161 (465 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15625| Best HMM Match : E1_dh (HMM E-Value=0) 89 1e-18 SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 28 3.3 >SB_15625| Best HMM Match : E1_dh (HMM E-Value=0) Length = 352 Score = 89.4 bits (212), Expect = 1e-18 Identities = 39/66 (59%), Positives = 47/66 (71%) Frame = +1 Query: 268 YKLHKLDQGPATSATLTSEDALKLYEXLTILRRIETASGNLYKEKIIRGFCHLYSGQEAV 447 Y LHK+ GP A +T E+ L Y + I+RR+ETA+ NLYK K+IRGFCHLYSGQEA Sbjct: 2 YTLHKITDGPPGKAVMTREEGLTYYRQMQIVRRMETAASNLYKSKVIRGFCHLYSGQEAC 61 Query: 448 AVGMRA 465 VGM A Sbjct: 62 CVGMEA 67 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 28.3 bits (60), Expect = 3.3 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +1 Query: 160 AAKFLAGNTITKVTAPVVATNAKYSTKKEATFEIKPYKLHKLDQGPATSATLTSEDALKL 339 A+ LA T+++V VV N + E TF+ LD AT A + LK Sbjct: 2125 ASPTLAETTVSEVD--VVLHNKAQALSTEETFDFSSGDNTNLDASGATEAQFQKTNPLKR 2182 Query: 340 YEXLTILR 363 + +T+L+ Sbjct: 2183 LDPVTVLQ 2190 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,449,961 Number of Sequences: 59808 Number of extensions: 234870 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 957531822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -