BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30160 (709 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.60 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 2.4 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 3.2 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 7.4 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 7.4 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 7.4 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 7.4 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 9.8 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.60 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 615 TTPA-TNPRRPRVAAC*PVSSDIKDLVKESMPISSCAVKKASVF 487 T+P+ TN + P SSD+ L+KE+MP+ V+ V+ Sbjct: 424 TSPSNTNTSTSSTNSNKPNSSDLNMLIKETMPLPRKLVRGQDVW 467 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.0 bits (47), Expect = 2.4 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -3 Query: 503 RKLRSFQGHVSIRSTPDSFVS---S*PRCVTAREFR 405 RK S H S + T DSF+S S +C + RE + Sbjct: 385 RKSTSSSTHTSSQQTSDSFLSKRNSEKKCGSLREIK 420 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = -2 Query: 561 SSDIKDLVKESMPISSCAVKKA 496 + +IKDL+++ PI++C + +A Sbjct: 34 TEEIKDLLQKYPPIANCKLVQA 55 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 684 RRKTLPLEIRHSIRSNAGTRSRWTTPATN 598 RRKT P + + + +++ TPA N Sbjct: 301 RRKTNPAGVTTTTKGKVRAKTQNATPANN 329 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 276 ANSGTSRPRCTKMVSTFPPSRKP 344 A SG P+ V+ PP+R P Sbjct: 101 AGSGNLSPQIQTQVARPPPARSP 123 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 276 ANSGTSRPRCTKMVSTFPPSRKP 344 A SG P+ V+ PP+R P Sbjct: 101 AGSGNLSPQIQTQVARPPPARSP 123 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 684 RRKTLPLEIRHSIRSNAGTRSRWTTPATN 598 RRKT P + + + +++ TPA N Sbjct: 301 RRKTNPAGVTTTTKGKVRAKTQNATPANN 329 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 31 IEDLAHLCFTLNGVLEIVQ 87 ++D LC NG+LE+++ Sbjct: 356 MDDFLGLCGPKNGLLEVIK 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,630 Number of Sequences: 336 Number of extensions: 3929 Number of successful extensions: 17 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -