BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30158 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40103| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 9.2 >SB_40103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 118 NGALTGQVSPSSQNTNIIRHQSLWTFIRIRGTKSLQ 225 +G TG +PS +TNIIRH + + T ++ Sbjct: 57 SGITTGTATPSVNSTNIIRHYYWHRYAHVNSTNIIR 92 >SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 700 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 136 QVSPSSQNTNIIRHQSLWT 192 QVS SS TN +RH+S+W+ Sbjct: 458 QVSKSSNFTNSLRHKSVWS 476 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,728,067 Number of Sequences: 59808 Number of extensions: 430089 Number of successful extensions: 1041 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -