BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30158 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 1.9 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 4.3 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +3 Query: 480 QENIFSNWLEEKVDLPSIFENISEVPERVDPQPPAAVLASSPFVTSQP 623 + ++ S+ + E + F N+S VP +PPA + ++ P Sbjct: 365 KSHVKSHTISELSPFTTYFVNVSAVPTDYSYKPPAKITVTTQMAARSP 412 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 4.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 543 ISEVPERVDPQPPAAVLASSPFVTSQPTE 629 ++ P + P PPA ASS V QPTE Sbjct: 932 VAAAPTQQQPLPPAPAAASSAGV--QPTE 958 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,475 Number of Sequences: 2352 Number of extensions: 13888 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -