BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30157 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.04 |atp16||F1-ATPase delta subunit |Schizosaccharomyces... 85 9e-18 SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|... 25 7.5 SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 re... 25 9.9 >SPBC13E7.04 |atp16||F1-ATPase delta subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 160 Score = 85.0 bits (201), Expect = 9e-18 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 1/120 (0%) Frame = +2 Query: 128 VRNYADA-PKGDEMALTFAAGNKVFYDKQVVKQIDVPSFSGAFGILPKHVPTLAVLRPGV 304 +R YA A K +++ L+ A + Y+K V Q+D+P+ G GIL HVP + L+PGV Sbjct: 18 IRGYAQAVQKNEKLVLSMALPYQTIYEKVPVTQVDIPAEDGEMGILKDHVPMIQCLKPGV 77 Query: 305 VTILENDGKQNKIFVSSGTITVNDDSSVQVLAEEAHPLESIDRSAAQEALSKAQSEFNSA 484 +++ + ++K F+S G + + + EA+ LE S A + L K ++E NS+ Sbjct: 78 ISVTDESSNKSKYFISGGFAVQQPSNELSITVPEAYKLEDFSSSVANQLLEKHKAEMNSS 137 >SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 25.4 bits (53), Expect = 7.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 206 KQVVKQIDVPSFSGAFGILPKHVPTLAVLRPGVVTILENDG 328 + V+ +++VP + I P VP L L LE DG Sbjct: 427 ESVLPEVNVPPITTFSIIRPSRVPALRFLAAPATRTLERDG 467 >SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 138 MQMLPKVTKWH*PSLRVIRSFMTNKLSNK 224 +Q P + +W +LR + F+TNKL NK Sbjct: 336 LQPCPSLAEWD--ALRKVWLFITNKLLNK 362 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,215,969 Number of Sequences: 5004 Number of extensions: 39775 Number of successful extensions: 82 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -