BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30157 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47030.1 68418.m05796 ATP synthase delta' chain, mitochondria... 69 3e-12 At5g17660.1 68418.m02070 expressed protein contains Pfam profile... 30 1.6 At5g09740.1 68418.m01128 histone acetyltransferase, putative sim... 30 1.6 At5g17490.1 68418.m02052 gibberellin response modulator, putativ... 28 6.5 At5g64610.1 68418.m08119 histone acetyltransferase, putative sim... 27 8.6 >At5g47030.1 68418.m05796 ATP synthase delta' chain, mitochondrial identical to SP|Q96252 ATP synthase delta' chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile PF02823: ATP synthase, Delta/Epsilon chain, beta-sandwich domain Length = 203 Score = 68.9 bits (161), Expect = 3e-12 Identities = 34/91 (37%), Positives = 58/91 (63%) Frame = +2 Query: 215 VKQIDVPSFSGAFGILPKHVPTLAVLRPGVVTILENDGKQNKIFVSSGTITVNDDSSVQV 394 V + +P+ +G G+LP HVPT+A L+PG++++ E + K F+SSG ++ +S + Sbjct: 90 VDMVIIPASTGQMGVLPGHVPTIAELKPGIMSVHEGTDVK-KYFLSSGFAFLHANSVADI 148 Query: 395 LAEEAHPLESIDRSAAQEALSKAQSEFNSAS 487 +A EA PL+ ID S Q+ L++ Q + SA+ Sbjct: 149 IAVEAVPLDHIDPSQVQKGLAEFQQKLASAT 179 >At5g17660.1 68418.m02070 expressed protein contains Pfam profile PF02390: Putative methyltransferase Length = 312 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/55 (36%), Positives = 29/55 (52%) Frame = +2 Query: 266 KHVPTLAVLRPGVVTILENDGKQNKIFVSSGTITVNDDSSVQVLAEEAHPLESID 430 +H V +P V +IL+N KIFV S + V D Q L EE++ L+ +D Sbjct: 214 RHQKRRVVQKPLVNSILQNLKPGGKIFVQSDVLDVAQDMRDQ-LDEESNVLQHMD 267 >At5g09740.1 68418.m01128 histone acetyltransferase, putative similar to histone acetyltransferase [Homo sapiens] gi|8317213|gb|AAF72665 Length = 445 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 266 KHVPTLAVLRPGVVTILENDGKQNKIFVSS 355 KH P + R G +++ E DGK+NK++ + Sbjct: 228 KHPPGDEIYRSGTLSMFEVDGKKNKVYAQN 257 >At5g17490.1 68418.m02052 gibberellin response modulator, putative / gibberellin-responsive modulator, putative putative member of the VHIID domain transcription factor family RGAL - Arabidopsis thaliana, EMBL:AJ224957 Length = 523 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +2 Query: 254 GILPKHVPTLAVLRPGVVTILENDGKQN-KIFVSSGTITVNDDSSVQVLAEEAHPLESID 430 G + K + T+ ++PG+VT++E + N +F+ ++ SS+ E+ + S D Sbjct: 364 GSIEKLLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLEDGVVIPSQD 423 Query: 431 RSAAQEALSK 460 R ++ L + Sbjct: 424 RVMSEVYLGR 433 >At5g64610.1 68418.m08119 histone acetyltransferase, putative similar to histone acetyltransferase [Homo sapiens] gi|8317213|gb|AAF72665 Length = 445 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 266 KHVPTLAVLRPGVVTILENDGKQNKIFVSS 355 KH P + R +++ E DGK+NK++ + Sbjct: 228 KHPPGDEIYRSSTLSMFEVDGKKNKVYAQN 257 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,386,397 Number of Sequences: 28952 Number of extensions: 205135 Number of successful extensions: 427 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -