BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30156 (630 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF361354-1|AAL50049.1| 426|Homo sapiens voltage-dependent calci... 31 4.5 AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. 30 5.9 >AF361354-1|AAL50049.1| 426|Homo sapiens voltage-dependent calcium channel gamma-8 subunit protein. Length = 426 Score = 30.7 bits (66), Expect = 4.5 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +1 Query: 235 HSLFYLKLGAGMTPDVAREPQSPTARRPSGSAVARAPPTTRFQRHAQPRVSELLRRFEP 411 H+ F + G G+T V R P P R P+ SA A P T + A + L R+ P Sbjct: 370 HNAFPKEAGGGVTVTVTRPPAPPAPRHPAPSAPA---PGTLAKGAAASNTNTLNRKTTP 425 >AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. Length = 1957 Score = 30.3 bits (65), Expect = 5.9 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 247 YLKLGAGMTPDVAREPQSPTARRPS-GSAVARAPPTTRFQRHAQPRVSELLRRFEPA 414 Y+ A M P + R PQ PS + ++RAP FQR + R+S F P+ Sbjct: 1230 YMSSSASMQP-ITRPPQPSYQTPPSLSNHISRAPSPASFQRSLENRMSPSKSPFLPS 1285 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,389,397 Number of Sequences: 237096 Number of extensions: 1724642 Number of successful extensions: 5860 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5852 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6860268620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -