SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30155
         (526 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     23   1.9  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   7.7  

>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 6/63 (9%)
 Frame = -3

Query: 374 SFFRMSHNAIFAQVHVEHDFIA------GQYGNDHVDSINGCSNGVGWRHSVLGRCVQCI 213
           +F RM  N I  Q+  + +  A      GQ G   +D+I       GW H +    V C 
Sbjct: 322 NFDRMQGNPICVQIPWDKNVEALAKWANGQTGFPWIDAIMTQLREEGWIHHLARHAVACF 381

Query: 212 FGR 204
             R
Sbjct: 382 LTR 384


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -3

Query: 524  SGHEGQGSVLSTHDS 480
            SGH G G +L+ +D+
Sbjct: 1929 SGHGGHGGLLTPYDT 1943


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 161,838
Number of Sequences: 438
Number of extensions: 4103
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14722920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -