BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30154 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0) 27 7.2 >SB_6404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +2 Query: 335 FDNNQSYSIFIAISKANKN-HNMNL-NSDKY 421 FDNNQ F I K NK HN NL NS++Y Sbjct: 37 FDNNQLPHTFDKIFKLNKQIHNYNLRNSNEY 67 >SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 689 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 317 LKYSVNFDNNQSYSIFIAISKANKNHNMNLNSD 415 ++YS++ N+ S S + S +N N+N N NS+ Sbjct: 553 VQYSISISNSNSNSNSNSNSNSNSNNNSNSNSN 585 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,267,618 Number of Sequences: 59808 Number of extensions: 195020 Number of successful extensions: 399 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -