BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30152 (723 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter... 28 5.9 AC006617-5|AAF39775.1| 325|Caenorhabditis elegans Serpentine re... 28 5.9 U58748-1|ABN43078.1| 173|Caenorhabditis elegans Hypothetical pr... 28 7.8 >U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 3 protein. Length = 302 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 591 NHVNGLQFVYNI*VDYYQSRQCDFWTLLV 677 NHV LQ V N VD+ ++R D W +V Sbjct: 38 NHVQHLQSVMNSEVDFCKTRSRDLWREMV 66 >AC006617-5|AAF39775.1| 325|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 65 protein. Length = 325 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = -2 Query: 410 YLNTTIVSLYWYDIYYTKLNTKWRDHKAMATLRP 309 YL+ + V+++ +Y+ + + W+ H+AM L+P Sbjct: 186 YLDNSTVAMFLVTLYFPMIGSYWK-HQAMKLLKP 218 >U58748-1|ABN43078.1| 173|Caenorhabditis elegans Hypothetical protein ZK180.7 protein. Length = 173 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 80 CCSTNVCNRCIYLYSCDSGSLCHSMNPNVETD 175 CCSTN+CN + D L S NV TD Sbjct: 117 CCSTNLCNDVNHKRVYDKYGLLISFADNVFTD 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,513,226 Number of Sequences: 27780 Number of extensions: 304599 Number of successful extensions: 761 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -