BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30147 (738 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19F8.04c |||nuclease|Schizosaccharomyces pombe|chr 2|||Manual 26 4.9 SPAC17G8.08c |||human TMEM165 homolog|Schizosaccharomyces pombe|... 26 6.4 >SPBC19F8.04c |||nuclease|Schizosaccharomyces pombe|chr 2|||Manual Length = 230 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 112 KQDRVSHMVIS-SYYKFRYFQMKKTP*PQELKKGLNYLFK 228 K DR + +V YY +F KK PQ ++KGL +++ Sbjct: 146 KIDRYARLVAGVQYYPIPHFFWKKDIGPQMIRKGLAVVYE 185 >SPAC17G8.08c |||human TMEM165 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.8 bits (54), Expect = 6.4 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 444 VAFRII*NYSVTSNVPSHRD*VHPYLRDYLKSLHFS 337 VA +I+ + H + VHP RD+L+SL FS Sbjct: 18 VAKKIVGEGMADVSAIKHPEEVHPTNRDFLRSLIFS 53 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,920,551 Number of Sequences: 5004 Number of extensions: 60282 Number of successful extensions: 160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -