BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30146 (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 25 0.65 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 4.6 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 22 4.6 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 21 8.0 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 25.0 bits (52), Expect = 0.65 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = +1 Query: 172 AFSPLDPSSFSRPEQAVIKHVTLSLN---VDFENKVLNGSATLDVDVLQDIGDVVL 330 AF+ L S + P + K TL L +DF VL+ LDVD++ ++ V+ Sbjct: 115 AFASLRKSIPTMPSDKLSKIQTLKLAARYIDFLYHVLSNENALDVDLIGNVCSYVV 170 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 636 ISELYKWSVLTRKNRSGMNRLTLTE*IRMF 547 ++ LY W +LT+ SG+ T+ + + F Sbjct: 46 LTSLYIWFILTQMTFSGVTSPTIMKFVLSF 75 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 636 ISELYKWSVLTRKNRSGMNRLTLTE*IRMF 547 ++ LY W +LT+ SG+ T+ + + F Sbjct: 46 LTSLYIWFILTQMTFSGVTSPTIMKFVLSF 75 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -3 Query: 678 HQYCELLGRRDFGIISELYKWSV 610 H +G RD G++S L W + Sbjct: 52 HLLYAFVGLRDDGVVSVLDDWEI 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,921 Number of Sequences: 336 Number of extensions: 3043 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -