BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30146 (752 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 27 0.82 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 25 3.3 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 26.6 bits (56), Expect = 0.82 Identities = 21/72 (29%), Positives = 34/72 (47%) Frame = +1 Query: 19 LKTSFFRNKIAFFVPVRLINWKHSKVRHSLINFGLHTKQTRSRFSQVPVMGAFSPLDPSS 198 + T RNKIA FV + +HS+VR I+ L ++ R + VP + A D Sbjct: 41 IPTKPLRNKIAGFVTHLMKRLRHSQVRG--ISIKLQEEERERRDNYVPDVSALEQ-DIIE 97 Query: 199 FSRPEQAVIKHV 234 + ++KH+ Sbjct: 98 VDPETKEMLKHL 109 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = +1 Query: 223 IKHVTLSLNVDFENKVLNGSATLDVDVLQDIGDVVLDSSELTIESIELDGAQLTYKLDDP 402 I H NVD K L G A + LQD+ +++ S ++ + D P Sbjct: 298 IYHTLNMFNVDVSKKCLFGEAWVPTAGLQDVKTALVNGSAAVGSAVPSFLNIIATDEDPP 357 Query: 403 VPNYGSKLT 429 N +K T Sbjct: 358 TYNKTNKFT 366 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,867 Number of Sequences: 2352 Number of extensions: 12809 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -