BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30146 (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 27 0.19 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 27 0.19 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 24 1.8 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 7.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.4 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 27.1 bits (57), Expect = 0.19 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +1 Query: 457 GDKLKIKIKYTTSPSATALQWLQPAQTSGKKHPY-LFSQC-----QPIHARSILPCQDTP 618 G IK+ +SP A + WL P + +G Y L+++ + H + LP ++T Sbjct: 1215 GSPADIKV-VVSSPQALFISWLPPLEPNGIITKYNLYTRVVDGREELNHGKRTLPAKNTY 1273 Query: 619 FVKFTYDAEVTAPEEFTVLMSALRGESRSTK 711 F D + +F V S GE +S+K Sbjct: 1274 FE--ATDLQQHVEYQFWVTGSTRVGEGQSSK 1302 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 27.1 bits (57), Expect = 0.19 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +1 Query: 457 GDKLKIKIKYTTSPSATALQWLQPAQTSGKKHPY-LFSQC-----QPIHARSILPCQDTP 618 G IK+ +SP A + WL P + +G Y L+++ + H + LP ++T Sbjct: 1211 GSPADIKV-VVSSPQALFISWLPPLEPNGIITKYNLYTRVVDGREELNHGKRTLPAKNTY 1269 Query: 619 FVKFTYDAEVTAPEEFTVLMSALRGESRSTK 711 F D + +F V S GE +S+K Sbjct: 1270 FE--ATDLQQHVEYQFWVTGSTRVGEGQSSK 1298 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 KQTRSRFSQVPVMGAFSPLDPSSFSRPEQAVIK 228 K R+RF +P++ + + DP F P + V++ Sbjct: 222 KSARTRFDILPLILSANGHDPDYFDIPNELVLE 254 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 546 ETSLSIQSVSADSCQIYSSVSRH 614 E ++S +S SADSCQ+ RH Sbjct: 373 ECNISPRS-SADSCQVGIMAQRH 394 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 169 GAFSPLDPSSFSRPEQAV 222 GA S +DP ++ P QAV Sbjct: 604 GARSYVDPHTYEDPNQAV 621 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,656 Number of Sequences: 438 Number of extensions: 3593 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -