BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30145 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 1.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 7.3 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 24.2 bits (50), Expect = 1.0 Identities = 15/72 (20%), Positives = 33/72 (45%) Frame = +1 Query: 64 ENVSVQXXXXXXXXXXXYYVGYMCFVLKKKVVILWILINRT*VIYFVFTLRYFLSFHFSF 243 +N+S++ + + ++ +V ILWI++ +Y + +Y+ +F Sbjct: 278 DNISLRARKQVVLMLGTVVLSFFLCLIPFRVFILWIILVPEEQVYHLEIEKYYNILYFC- 336 Query: 244 DRRKKIFLNSQI 279 R ++LNS I Sbjct: 337 --RIMVYLNSAI 346 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 521 FGLLVFILVELLSS*CSTATMN 586 +G+LV I+ L+++ +T T+N Sbjct: 379 WGILVLIIAPLIATLIATVTVN 400 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,842 Number of Sequences: 336 Number of extensions: 2620 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -