BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= maV30143
(520 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 1.9
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 23.0 bits (47), Expect = 1.9
Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 6/63 (9%)
Frame = -2
Query: 384 SFFRMSHNAIFAQVHVEHDFIA------GQYGNDHVDSINGCSNGVGWRHSVLGRCVQCI 223
+F RM N I Q+ + + A GQ G +D+I GW H + V C
Sbjct: 322 NFDRMQGNPICVQIPWDKNVEALAKWANGQTGFPWIDAIMTQLREEGWIHHLARHAVACF 381
Query: 222 FGR 214
R
Sbjct: 382 LTR 384
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.316 0.132 0.373
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,182
Number of Sequences: 438
Number of extensions: 3864
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14477538
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
- SilkBase 1999-2023 -