BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30142 (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 26 0.26 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 26 0.26 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.59 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 3.2 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 23 3.2 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 7.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.3 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 26.2 bits (55), Expect = 0.26 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 249 FVKITYVMYLTKLASAWLKCQRTPNCTQSCWSHLLC 356 + T +Y T L +A C TPN T + WSH C Sbjct: 122 YYHFTLELY-TVLGAACQVC--TPNATNTVWSHCQC 154 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 26.2 bits (55), Expect = 0.26 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 249 FVKITYVMYLTKLASAWLKCQRTPNCTQSCWSHLLC 356 + T +Y T L +A C TPN T + WSH C Sbjct: 122 YYHFTLELY-TVLGAACQVC--TPNATNTVWSHCQC 154 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 405 KPTRLWWSPCSEKPKQTTRIRSRRMLC*KSTPRTFCRPT 521 KP+ WWS + P TT R +T T RPT Sbjct: 1038 KPST-WWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPT 1075 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 3.2 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 338 LVTLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQTDYKNKIKKDVV 484 LV++ + L +L E + R+ DKA E L ++ NK++K VV Sbjct: 530 LVSVTKEGL-ELPEDEEEKKKREEDKAKFEGLCKVMKSILDNKVEKVVV 577 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -1 Query: 269 YVRDLHELSVPSDELGSACSKIGSSSEVQPASPS 168 Y DL S+ EL + GSS QPA+ S Sbjct: 223 YYGDLDLKSIRKSELLAGLQSSGSSRSHQPATKS 256 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 92 PSHRFLRPF 66 P HRFL PF Sbjct: 376 PDHRFLEPF 384 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 376 GTHCHHPRPSNRQGSGGVPARKSPNRLQ 459 G H PS G+GG+P + R Q Sbjct: 255 GLHATGSAPSPTAGAGGLPPQVPSPRSQ 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,465 Number of Sequences: 336 Number of extensions: 3057 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -