BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30141 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55174| Best HMM Match : AP_endonuc_2 (HMM E-Value=2.4e-36) 117 1e-26 SB_59052| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50102| Best HMM Match : Phage_fiber (HMM E-Value=8.2e-06) 30 2.2 SB_23440| Best HMM Match : BAT2_N (HMM E-Value=7.5) 30 2.2 SB_13226| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_14151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 29 5.0 SB_33304| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=7.00649e-45) 29 5.0 SB_36973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_55174| Best HMM Match : AP_endonuc_2 (HMM E-Value=2.4e-36) Length = 260 Score = 117 bits (281), Expect = 1e-26 Identities = 70/237 (29%), Positives = 115/237 (48%), Gaps = 2/237 (0%) Frame = +3 Query: 12 MKFCANLSFMFAEASSILERYALAKDAGFKAVESGFPFGFSLEQVRNAKQSAGLQQIAIN 191 MK ANLS +F E ++ER A AGF VE FP+ +++ A ++AG+ IN Sbjct: 1 MKIAANLSLLFTELP-LIERVVAAAAAGFDGVEIQFPYELPAIRLKEALEAAGMPLRLIN 59 Query: 192 LKTGDTTKGEVGVTSVPGKEDEFKTNLNTTIEYAKALDAKKIHIMAGKV-ENPTPKH-WE 365 L GD G G+ ++P ++ EF L + YA + ++++ G++ + P+ Sbjct: 60 LPAGDLMSGGPGLAAMPARQAEFDLALKDALSYAAMVRPALVNVLPGRLADGVEPEQALA 119 Query: 366 TFEKNLLYAVDVLKGENIQGLIEPINQYSMPKYFLSDYGRAVDIIKRIDSPNLRLMLDIF 545 NL + + I ++E IN +P + ++ + ++K + PNL D++ Sbjct: 120 CLVDNLHKTAEAFQLLGIGVVVEAINPLDIPGFLINTPEQLDALLKAVAHPNLAAQYDLY 179 Query: 546 HLQQIAGDITHNITKLLPYIGHVQIAQVPNRNEPDTPGEINYKYVLEHLAKSGYDEW 716 H+ + D+ I L IGHVQ A P R P T GE+ + +L L SGY W Sbjct: 180 HMARQGLDVQAGIVLLAGRIGHVQFADYPGRGAPGT-GELQFAPLLTALRDSGYQGW 235 >SB_59052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 33.5 bits (73), Expect = 0.18 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = +3 Query: 228 VTSVPGKEDEFKTNLNTTIEYAKALDAKKIHIMAGKVENPTPKHWET---FEKNLLYAVD 398 + SV E+ ++ +L+ +++ +KA ++ + +M GK +PT + W+T F N L+ + Sbjct: 84 ILSVRDNEEIWRKSLDKSLQVSKA-SSRSLWMMVGKQISPTGRKWKTIQDFISNTLFLKN 142 Query: 399 VLKGENI 419 K NI Sbjct: 143 TDKDSNI 149 >SB_50102| Best HMM Match : Phage_fiber (HMM E-Value=8.2e-06) Length = 274 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = -2 Query: 614 HMSNVWQ*FRNIMSNVASDLLKMKNVQHQSQIWTVNTFNNVHSSSIITQ 468 H S++W N N S LL N H S++WT N H+SS+ TQ Sbjct: 17 HNSSLWT-QGNTTHN--SSLLTQGNTTHNSRLWTQG--NTTHNSSLWTQ 60 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = -2 Query: 614 HMSNVWQ*FRNIMSNVASDLLKMKNVQHQSQIWTVNTFNNVHSSSIITQ 468 H S++W N N S LL N H S +WT N H+SS+ TQ Sbjct: 174 HNSSLWT-QGNTTHN--SSLLTQGNTTHNSSLWTQG--NTTHNSSLWTQ 217 >SB_23440| Best HMM Match : BAT2_N (HMM E-Value=7.5) Length = 262 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +3 Query: 546 HLQQIAGDITHNITKLLPYIG---HVQIAQVPNRNEPDT 653 H QQ+A +IT+N K P IG H Q AQ N P T Sbjct: 210 HHQQLAQNITNNRPKTSPTIGPKHHQQSAQNNTNNRPKT 248 >SB_13226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = -2 Query: 668 VYLSGRVRLVTIRNLSYLHMSNVWQ-*FRNIMSNVASDLLKMKNVQH-QSQIWTVNTFN 498 VY+ G VRL T +L + +W+ ++ I+ V + + +KN H + ++ TVN +N Sbjct: 17 VYIDGGVRLGTDARSVFLGRTVIWELAYKRIVFEVPGN-ITVKNAMHCEQKVVTVNDYN 74 >SB_14151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = -2 Query: 614 HMSNVWQ*FRNIMSNVASDLLKMKNVQHQSQIWTVNTFNNVHSSSIITQ 468 H S++W N N S LL N H S +WT N H+SS+ TQ Sbjct: 141 HNSSLWT-QGNTTHN--SSLLTQGNTTHNSSLWTQG--NTTHNSSLWTQ 184 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = +3 Query: 483 RAVDIIKRIDS---PNLRLMLDIFHLQQIAGDITH 578 R + ++K+ID+ PN+ +LDIFH+ + TH Sbjct: 52 REIALLKQIDNFAHPNVVRLLDIFHIPMLTARETH 86 >SB_33304| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=7.00649e-45) Length = 638 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/67 (22%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = +3 Query: 468 LSDYGRAVDII--KRIDSPNLRLMLDIFHLQQIAGDITHNITKLLPYIGHVQIAQVPNRN 641 ++ G AV +I + I P +L L FH+ +AG ++ + + + G +++ + Sbjct: 508 MTQKGEAVGVIAAQSIGEPGTQLTLRTFHVGGVAGGLSEESSIITKFKGRLEVEDLKTVK 567 Query: 642 EPDTPGE 662 D G+ Sbjct: 568 GEDADGK 574 >SB_36973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -2 Query: 560 DLLKMKNVQHQSQI-WTVNTFNNVHSSSIITQEIFGHRILVDWFD 429 D++ +N Q + NTFN+ S + + IFGH DW + Sbjct: 153 DMMMSRNPQQMQNLDHAANTFNDCQSHTYQSNTIFGH---ADWME 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,247,952 Number of Sequences: 59808 Number of extensions: 429820 Number of successful extensions: 1245 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -