BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30138 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 26 1.0 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.4 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 5.4 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 26.2 bits (55), Expect = 1.0 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 547 ESNDFNGTDSTSII-LYSSGTTGLPKGVKLTHRNLLVT 657 ++N F G +S SI Y T P GV +TH L +T Sbjct: 5 DNNGFIGDNSPSIAGQYRWTTPAAPNGVHVTHGGLALT 42 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 2.4 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +3 Query: 51 LWRAKFFVSESHELWKIFIGETFERKSKSGFDQWS*RREIDIWRN-DTANCKYSFCY*TT 227 L RAK+F S + EL+ +TFE+ G Q S DIW A ++ CY T+ Sbjct: 2232 LIRAKYFQSSAEELFNPLRKDTFEQ--IQGISQES---STDIWHKLVDAGYLHTDCYSTS 2286 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.0 bits (52), Expect = 2.4 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +3 Query: 51 LWRAKFFVSESHELWKIFIGETFERKSKSGFDQWS*RREIDIWRN-DTANCKYSFCY*TT 227 L RAK+F S + EL+ +TFE+ G Q S DIW A ++ CY T+ Sbjct: 2233 LIRAKYFQSSAEELFNPLRKDTFEQ--IQGISQES---STDIWHKLVDAGYLHTDCYSTS 2287 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 75 SESHELWKIFIGETFERKSKSG 140 SE+ ELW + + +RK K G Sbjct: 222 SENGELWSTVVSKKAQRKKKMG 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,556 Number of Sequences: 2352 Number of extensions: 15323 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -