BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30136 (779 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 4.8 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 22 6.3 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 22 6.3 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 8.4 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 8.4 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +1 Query: 310 YRYFCTTSRHVLAFGFTELYIVLLFPSRALLIEWWWSYINPILMLSRCDAMWH 468 YR T+ LAF + +V + L + W + P + S+ ++WH Sbjct: 122 YRNLLETTTRRLAFVNSAYTLVKAYGFDGLDLAWEFPENKPKKIRSKLGSIWH 174 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 394 ALLIEWWWSYINPIL 438 ALL ++W YI PIL Sbjct: 338 ALLDDYWNEYIPPIL 352 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 394 ALLIEWWWSYINPIL 438 ALL ++W YI PIL Sbjct: 338 ALLDDYWNEYIPPIL 352 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 609 IFYYLVKMKLEW 574 + +YLVK K EW Sbjct: 84 VIHYLVKQKPEW 95 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 330 KPSCSCFWIHRIIYSSS 380 KP FW R++Y+++ Sbjct: 278 KPGVGVFWYARLLYATA 294 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,376 Number of Sequences: 336 Number of extensions: 3485 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -