BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30136 (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.6 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 8.0 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 8.0 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 8.0 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 8.0 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 4.6 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +1 Query: 478 VRAQQQKNQSHSGPS*TLLTT*NDVTI 558 VRA KN SHSG S L TT + TI Sbjct: 89 VRAFLLKNSSHSGASSGLNTTQVNTTI 115 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 455 SHRESIRIGLMYDHHHSIKSARLGKRRTIYNSVN 354 S R+S+ +G + HH S + YN +N Sbjct: 135 SERDSVMLGEISPHHEYFDSKSSSETPPSYNQLN 168 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 455 SHRESIRIGLMYDHHHSIKSARLGKRRTIYNSVN 354 S R+S+ +G + HH S + YN +N Sbjct: 135 SERDSVMLGEISPHHEYFDSKSSSETPPSYNQLN 168 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 455 SHRESIRIGLMYDHHHSIKSARLGKRRTIYNSVN 354 S R+S+ +G + HH S + YN +N Sbjct: 135 SERDSVMLGEISPHHEYFDSKSSSETPPSYNQLN 168 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 455 SHRESIRIGLMYDHHHSIKSARLGKRRTIYNSVN 354 S R+S+ +G + HH S + YN +N Sbjct: 135 SERDSVMLGEISPHHEYFDSKSSSETPPSYNQLN 168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,313 Number of Sequences: 2352 Number of extensions: 13954 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -