BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30136 (779 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114366-1|AAI14367.1| 663|Homo sapiens cyclin T2 protein. 30 8.1 AY865621-1|AAW56073.1| 730|Homo sapiens cyclin T2 protein. 30 8.1 AF048732-1|AAC39666.1| 730|Homo sapiens cyclin T2b protein. 30 8.1 AF048731-1|AAC39665.1| 663|Homo sapiens cyclin T2a protein. 30 8.1 AC016725-2|AAY14998.1| 730|Homo sapiens unknown protein. 30 8.1 >BC114366-1|AAI14367.1| 663|Homo sapiens cyclin T2 protein. Length = 663 Score = 30.3 bits (65), Expect = 8.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 412 WWSYINPILMLSRCDAMWHDFIVRAQQQKNQ 504 WW Y++P + L D + H+F+ ++ N+ Sbjct: 220 WWEYVDPTVTLELLDELTHEFLQILEKTPNR 250 >AY865621-1|AAW56073.1| 730|Homo sapiens cyclin T2 protein. Length = 730 Score = 30.3 bits (65), Expect = 8.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 412 WWSYINPILMLSRCDAMWHDFIVRAQQQKNQ 504 WW Y++P + L D + H+F+ ++ N+ Sbjct: 220 WWEYVDPTVTLELLDELTHEFLQILEKTPNR 250 >AF048732-1|AAC39666.1| 730|Homo sapiens cyclin T2b protein. Length = 730 Score = 30.3 bits (65), Expect = 8.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 412 WWSYINPILMLSRCDAMWHDFIVRAQQQKNQ 504 WW Y++P + L D + H+F+ ++ N+ Sbjct: 220 WWEYVDPTVTLELLDELTHEFLQILEKTPNR 250 >AF048731-1|AAC39665.1| 663|Homo sapiens cyclin T2a protein. Length = 663 Score = 30.3 bits (65), Expect = 8.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 412 WWSYINPILMLSRCDAMWHDFIVRAQQQKNQ 504 WW Y++P + L D + H+F+ ++ N+ Sbjct: 220 WWEYVDPTVTLELLDELTHEFLQILEKTPNR 250 >AC016725-2|AAY14998.1| 730|Homo sapiens unknown protein. Length = 730 Score = 30.3 bits (65), Expect = 8.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 412 WWSYINPILMLSRCDAMWHDFIVRAQQQKNQ 504 WW Y++P + L D + H+F+ ++ N+ Sbjct: 220 WWEYVDPTVTLELLDELTHEFLQILEKTPNR 250 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,417,868 Number of Sequences: 237096 Number of extensions: 1858738 Number of successful extensions: 2764 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2764 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9478778060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -