BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30134 (573 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 189 2e-48 SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) 28 6.2 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 189 bits (460), Expect = 2e-48 Identities = 86/134 (64%), Positives = 101/134 (75%) Frame = +3 Query: 3 IGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVXXXXXXXXXX 182 IGR +P++ PPLYKMRIF+PD +VA+S+FWYF+ QLK+ KK+ GEIV Sbjct: 213 IGRLMPNKKLTVPPLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQIYEKKP 272 Query: 183 XXXXNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQIIKVEVI 362 NFGIWLRY+SRSG HNMYREYRDL+V GAVT CYRDM ARHRAR +SIQI+KVEVI Sbjct: 273 LQIKNFGIWLRYDSRSGTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQIMKVEVI 332 Query: 363 KAAACRRPQVKQFH 404 A+ RRP VKQ H Sbjct: 333 PASKARRPHVKQMH 346 >SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) Length = 300 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 333 SIQIIKVEVIKAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNT 464 S++I ++ AC P V HN +R + + VHH KR+ T Sbjct: 246 SLEITCFFLLHVNACCNPVVYSLHNPKLRKCMNRLVHH-KRVRT 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,920,202 Number of Sequences: 59808 Number of extensions: 364670 Number of successful extensions: 1164 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -