BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30133 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745234-1|AAU93513.1| 96|Anopheles gambiae thioredoxin-depend... 143 6e-36 AY800250-1|AAV68043.1| 97|Anopheles gambiae thioredoxin depend... 45 2e-06 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 27 0.63 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 26 1.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 3.3 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 4.4 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 5.9 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 24 5.9 >AY745234-1|AAU93513.1| 96|Anopheles gambiae thioredoxin-dependent peroxidase protein. Length = 96 Score = 143 bits (346), Expect = 6e-36 Identities = 67/95 (70%), Positives = 77/95 (81%) Frame = +3 Query: 297 LAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQITI 476 LAWINTPRK GGLG + PL++D + RIS DYGVL + GI RGLFIID +RQITI Sbjct: 1 LAWINTPRKAGGLGKLEYPLLADLTKRISADYGVLLPD-GISLRGLFIIDPAGVVRQITI 59 Query: 477 NDLPVGRSVEETLRLVQAFQFTDKHGEVCPANWRP 581 NDLPVGRSV+ETLRL++AFQF +KHGEVCPANW P Sbjct: 60 NDLPVGRSVDETLRLIKAFQFVEKHGEVCPANWEP 94 >AY800250-1|AAV68043.1| 97|Anopheles gambiae thioredoxin dependent peroxidase protein. Length = 97 Score = 45.2 bits (102), Expect = 2e-06 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +3 Query: 426 RGLFIIDDKQNLRQITINDLPVGRSVEETLRLVQAFQFTDKHGEVCPANWRPG-AKTIKP 602 R +F+ID + LR + GR+ E LR + + Q TDK PA+W PG + ++P Sbjct: 4 RAVFVIDAGKKLRLSILYPATTGRNFAEILRTIDSMQLTDKRRVATPADWMPGDSCMVQP 63 Query: 603 DTKAAQ 620 A Q Sbjct: 64 TVPADQ 69 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 27.1 bits (57), Expect = 0.63 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 429 LGRECPSPRPALRSRGRCGATCRLSEECS 343 + REC SP ++ RCGA L+++C+ Sbjct: 373 IARECRSPVDRQKACIRCGAEGHLAKDCN 401 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 350 SSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRP 484 S +RQ+ + + +G+ + P+ R+Q +PQ QRP Sbjct: 429 SQRQRQLQQQQQQQQQQQQGERYVPPQLRQQRQQQQPQQQQQQRP 473 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.6 bits (51), Expect = 3.3 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = -2 Query: 574 QLAGHTSPCLSVNWKACTSRRVSSTDLPTGRSLIVICLRFCLSSMMKSPRKGMPVSSSST 395 ++AG T C S + K TS R S +D +G I + +SP P SST Sbjct: 1333 RIAGETFECTSTSSKFSTSSRGSGSD--SGSHSISSAAQHDFQGSHRSPNGCAPNLLSST 1390 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.2 bits (50), Expect = 4.4 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 551 RRGVPRQLEARRQDHQARHQG 613 R +P+Q + ++Q HQ H G Sbjct: 147 RHHLPQQYQQQQQQHQLEHNG 167 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 509 LLHRPPHGQVVDRDLPEVLLVVDDEESSEGNARLLVQH 396 LL P Q + P+ L DD++S+ + ++ QH Sbjct: 463 LLDEEPKQQSQQQQRPDSALAEDDKDSTRESPAIVEQH 500 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 429 LGRECPSPRPALRSRGRCGATCRLSEECS 343 L R+C SP ++ RCGA ++ C+ Sbjct: 399 LARDCQSPVDRQQACIRCGADGHYAKSCT 427 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,665 Number of Sequences: 2352 Number of extensions: 12656 Number of successful extensions: 43 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -