BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30132 (632 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 31 0.76 06_03_0237 + 18576317-18576412,18577273-18577778,18577906-185780... 29 4.1 01_06_1016 + 33830751-33831387,33831470-33831527,33831620-338317... 29 4.1 01_05_0272 + 20280557-20281220,20281799-20281938,20282035-202821... 29 4.1 09_04_0072 + 14323449-14324274,14324351-14324447,14325175-143252... 28 7.1 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 31.1 bits (67), Expect = 0.76 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +2 Query: 251 NLFCERVVKQCCSSFLVEEVNKSCLKMADLEAVLADVSYLMAMEKSKCTPAARASKK 421 N+F +++V++CC + N +++ D+E VL+D L E +K AA ASKK Sbjct: 630 NMFIDKIVRKCCDLGVQMNRNPCIVQLLDME-VLSDPHQLFE-ELNKAKQAA-ASKK 683 >06_03_0237 + 18576317-18576412,18577273-18577778,18577906-18578024, 18578409-18578763,18578803-18578866,18578967-18579231, 18579354-18579529 Length = 526 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 392 CTPAARASKKIVLPDPSVRSVMHKYMEK-KNEVNFDKIFNQVLGYLLFKEFCEQT 553 CT RA + L ++ +Y +K K++V FD+ + G ++FK+ QT Sbjct: 472 CTHMLRAFVHVQLEKIPAAYILKRYTKKVKSDVPFDRHDREATGPMVFKKITGQT 526 >01_06_1016 + 33830751-33831387,33831470-33831527,33831620-33831703, 33831819-33831954,33833191-33833451 Length = 391 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +2 Query: 296 LVEEVNKSCLKMADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDPSVRSVMHK 463 L + + KS A L+ A + + EKS+ ARA+ +LP P+ SV K Sbjct: 36 LKKSLQKSLSMPASLDNAAAATTCAASPEKSRAADFARAAAASLLPPPTPASVSAK 91 >01_05_0272 + 20280557-20281220,20281799-20281938,20282035-20282124, 20282249-20282354,20282544-20282695,20282776-20282873, 20282948-20283086,20283223-20283321,20283411-20283575 Length = 550 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 297 RKEEQHCFTTRSQNKLFQLPPDSHNLLHMTT 205 R +E C TR LPP+S LHMTT Sbjct: 396 RSDEDECLATRLVGTPGYLPPESVLELHMTT 426 >09_04_0072 + 14323449-14324274,14324351-14324447,14325175-14325277, 14325359-14325412,14325495-14325569,14325597-14325650, 14325687-14325755,14325840-14325923,14326115-14326312, 14326428-14326927,14327011-14327140,14328226-14328317, 14328776-14328954,14329114-14329316,14329398-14329499, 14330047-14330209,14330690-14330979,14331088-14331225, 14331311-14331390,14331510-14331606,14331685-14331814, 14331921-14332162 Length = 1301 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 350 LADVSYLMAMEKSKCTPAARASKKIVLPDPSVRSVMHKY 466 L D+ L+A S C R+SK +VL + + + ++H++ Sbjct: 747 LPDMERLLARLFSSCDKNGRSSKSVVLYEDASKRLLHQF 785 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,439,270 Number of Sequences: 37544 Number of extensions: 318061 Number of successful extensions: 862 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -