BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30131 (658 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC104916-1|AAI04917.1| 852|Homo sapiens SHROOM1 protein protein. 33 1.2 BC104914-1|AAI04915.1| 852|Homo sapiens SHROOM1 protein protein. 33 1.2 AF314142-1|AAM15526.1| 847|Homo sapiens apical protein 2 protein. 33 1.2 AB075840-1|BAB85546.1| 871|Homo sapiens KIAA1960 protein protein. 33 1.2 U79668-1|AAB49678.1| 916|Homo sapiens alpha1A-voltage-dependent... 30 8.3 >BC104916-1|AAI04917.1| 852|Homo sapiens SHROOM1 protein protein. Length = 852 Score = 32.7 bits (71), Expect = 1.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 412 SPADQQSQLPS*CASTAWIARVHHPLTTHDG-LYRPRPPPEPNAHRAP 272 SPAD + ++ C AW+ + + + L R R PP+P+A + P Sbjct: 364 SPADSEQRVSETCIVPAWLPSLPDEVFLEEAPLVRMRSPPDPHASQGP 411 >BC104914-1|AAI04915.1| 852|Homo sapiens SHROOM1 protein protein. Length = 852 Score = 32.7 bits (71), Expect = 1.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 412 SPADQQSQLPS*CASTAWIARVHHPLTTHDG-LYRPRPPPEPNAHRAP 272 SPAD + ++ C AW+ + + + L R R PP+P+A + P Sbjct: 364 SPADSEQRVSETCIVPAWLPSLPDEVFLEEAPLVRMRSPPDPHASQGP 411 >AF314142-1|AAM15526.1| 847|Homo sapiens apical protein 2 protein. Length = 847 Score = 32.7 bits (71), Expect = 1.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 412 SPADQQSQLPS*CASTAWIARVHHPLTTHDG-LYRPRPPPEPNAHRAP 272 SPAD + ++ C AW+ + + + L R R PP+P+A + P Sbjct: 364 SPADSEQRVSETCIVPAWLPSLPDEVFLEEAPLVRMRSPPDPHASQGP 411 >AB075840-1|BAB85546.1| 871|Homo sapiens KIAA1960 protein protein. Length = 871 Score = 32.7 bits (71), Expect = 1.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 412 SPADQQSQLPS*CASTAWIARVHHPLTTHDG-LYRPRPPPEPNAHRAP 272 SPAD + ++ C AW+ + + + L R R PP+P+A + P Sbjct: 383 SPADSEQRVSETCIVPAWLPSLPDEVFLEEAPLVRMRSPPDPHASQGP 430 >U79668-1|AAB49678.1| 916|Homo sapiens alpha1A-voltage-dependent calcium channel protein. Length = 916 Score = 29.9 bits (64), Expect = 8.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 133 HHHHLHQPRLVCVMLAFFL 77 HHHH H R +C FFL Sbjct: 888 HHHHHHHHRFLCFFFPFFL 906 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,846,668 Number of Sequences: 237096 Number of extensions: 2094335 Number of successful extensions: 6608 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6587 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -